Vorwürfe esoterischer Betätigungen am „Institut für transkulturelle Gesundheitswissenschaften” der Viadrina, Frankfurt/Oder, gehen seit einiger Zeit durch die Medien. Durch Debatten hier auf scienceblogs und auf esowatch ist jetzt noch einmal eine Masterarbeit an jenem Institut ins Visier der Kritik geraten. Titel: „Der Kozyrev-Spiegel in der Praxis”.

Diese Arbeit eines Berliner Orthopäden ist ein Beispiel für die völlige Entgleisung akademischer Qualitätsstandards. Da werden in einer Aluminiumhülle geheimnisvolle telepathische Erfahrungen gemacht, da werden Raum-Zeit-Löcher generiert, da ist von „Zeitwellen”, von „abzuschirmender Zeitenergie” und einer Menge anderer Merkwürdigkeiten die Rede, die auf den ersten Blick als absurder Unsinn zu erkennen sind. Dazu nur zwei Beispiele:

„Ausgangspunkt der Zeitwellen-Theorie ist die Entdeckung (Vision von) einer physikalischen Strahlung, welche alle Lebewesen und Himmelskörper aussenden. Diese Strahlung dient dem Informationsaustausch, ist eng mit der Raum-Zeit verbunden und beeinflußt alle materiellen Körper in der physikalischen Raum-Zeit”.

Und über die Zeitwellen:

„Sie sind mit bestimmten Materialien spiegelbar, dabei kehrt sich das Vorzeichen um. Das bedeutet, daß im Zeitwellenmuster auch immer Informationen aus der Vergangenheit und aus der Zukunft enthalten sind”.

Behauptungen wie die erste kann man sonst nur in astrologischen Werken lesen, die zweite vielleicht in Science Fiction-Romanen. Die ganze Arbeit ist eine akademische Ungeheuerlichkeit. Dennoch wurde sie vom amtierenden Institutsdirektor Prof. Dr. Dr. Harald Walach und seinem Juniorprofessor Prof. Dr. Stefan Schmidt angenommen und sogar als „hervorragende” Arbeit gewürdigt. Guttenbergs Dissertation konnte man immerhin noch zugutehalten, dass sie – wenn auch weitgehend abgeschrieben – einen sinnvollen und wissenschaftlich gehaltvollen Text darstellt. Die Frankfurter Masterarbeit ist einfach nur Nonsens. Wie kann so etwas geschehen?

Walach sagt, und jetzt wird es ganz krude, die „Kozyrev-Theorie” sei zwar „abgedreht”, aber die Masterarbeit beschreibe „ein relativ pfiffiges Experiment”. Daher würde die Arbeit demnächst auch einem peer-reviewten Journal vorgelegt. Das „einzige Kriterium von Wissenschaft” sei „gute Methodik”. Das sei bei dieser Arbeit der Fall, sie sei „mit einer dreifach verblindeten, randomisierten Methodik durchgeführt.” Dass man auch „abgedrehte Theorien” methodisch korrekt untersuchen kann, ist zwar richtig. In diesem Fall wurde untersucht, ob sich mit einem „Kozyrev-Spiegel”, also der wunderlichen Aluminium-Vorrichtung, intuitive Fähigkeiten von Versuchspersonen verbessern lassen. Der Autor der Arbeit kommt zu einem positiven Ergebnis. Es sei einmal dahingestellt, ob nicht schon das affirmative Aufgreifen der Kozyrev-Theorie die Arbeit hätte disqualifizieren müssen, es sei auch dahingestellt, ob die Methode wirklich „pfiffig” und der Fragestellung angemessen war, aber spätestens bei der Ergebnisdiskussion gibt es keinen Spielraum mehr: Wenn man die Befunde nicht vernünftig, z.B. psychologisch deutet, sondern im Rückgriff auf die physikalisch nicht haltbare, selbst nach Walach „abgedrehte” Kozyrev-Theorie, muss Schluss sein. Was aller Vernunft widerspricht, ist keine Wissenschaft.

Davon abgesehen ist auch Walachs These, das einzige Kriterium von Wissenschaft sei gute Methodik, nicht unproblematisch. Demnach könnte man auch die Unterdruckexperimente des SS-Arztes Rascher im KZ Dachau als gute Wissenschaft durchgehen lassen. Irgendetwas fehlt offensichtlich in Walachs Bestimmung des Wissenschaftlichen. Gute Methodik ist nicht unabhängig davon, um welchen Untersuchungsgegenstand es geht und was dabei als Erkenntnisstand bereits gewonnen wurde. In der Physik stecken vorgängige physikalische Erkenntnisse in jedem Versuchsaufbau, in jedem Messinstrument, auch in der Messtheorie. In der Psychologie bestimmt das Gegenstandsverständnis, wo man mit dem Experiment und wo man mit anderen Methoden arbeitet. Methodik und Gegenstand, Methodik und Resultate – sie stützen sich gegenseitig. Was wäre das für eine Wissenschaft, wenn mit guten Methoden gewonnene Resultate keine wissenschaftliche Relevanz hätten? Wer die Physik des letzten Jahrhunderts infrage stellt, der stellt höchst relevante Resultate infrage, die sich in tausenden von Experimenten bestätigt haben und sich alltäglich millionenfach in technischen Anwendungen bewähren. Zwar sind auch die Fundamente der Physik nicht sakrosankt, aber ihre Revision wird sich sicher nicht über eine Masterarbeit an Walachs Institut vollziehen.

Am „Institut für transkulturelle Gesundheitswissenschaften” ist die Wissenschaft als Handwerk der Vernunft unter die Räder gekommen. Die Viadrina wäre gut beraten, hier wieder die notwendigen Qualitätstandards wissenschaftlichen Arbeitens durchzusetzen, bevor Masterabschlüsse der Viadrina insgesamt in Misskredit geraten.

Der Ombudsmann der Deutschen Forschungsgemeinschaft, der bei Fragen wissenschaftlichen Fehlverhaltens vermitteln soll, erklärte sich auf Anfrage für nicht zuständig. Man greife konkrete Hinweise auf wissenschaftliches Fehlverhalten entsprechend der DFG-Denkschrift zur „Sicherung guter wissenschaftlicher Praxis” auf, zu Streitigkeiten über die „Qualität wissenschaftlicher Arbeiten” könne man sich nicht äußern. Aber geht es hier überhaupt um die Qualität einer „wissenschaftlichen” Arbeit?

Das Brandenburgische Wissenschaftsministerium, ebenfalls angeschrieben, hat sich bisher nicht geäußert. Ob es den Konflikt mit dem in der SPD prominenten Präsidenten der Viadrina scheut oder keine Meinung zu den Vorgängen hat – man weiß es nicht. Angesichts der in der Masterarbeit erwähnten „aurachirurgischen” Behandlungen wäre außerdem auch die zuständige Ärztekammer gut beraten, sich die Sache einmal näher anzusehen.

In diesem ganzen Fall bestehen deutliche Parallelen zur Guttenberg-Affäre. Offenkundig ist den Beteiligten das Gefühl dafür abhandengekommen, was Wissenschaft ist und was nicht. Es fehlt so etwas wie die Radbruchsche Formel in den Rechtswissenschaften. Als sich nach dem Krieg immer wieder Nazi-Verbrecher darauf beriefen, ihre Taten seien durch das damals geltende Recht gedeckt gewesen, hat Gustav Radbruch eine Unterscheidung vorgeschlagen, derzufolge manche gesetzliche Vorschriften aufgrund ihres offenkundigen Unrechts kein Recht sein könnten. Im Institut des Herrn Walach scheint man für diese Differenzierung kein Gespür zu haben; hier bezeichnen Professoren Arbeiten als hervorragende Leistungen, die zwar als Wissenschaft auftreten, aber keine Wissenschaft sind.

Für den Frankfurter Studiengang geht es auch um die Akkreditierung bei der AHPGS, der Akkreditierungsagentur für Studiengänge im Bereich Gesundheit und Soziales. Werden solche Studiengänge akkreditiert, ist der Fortschritt der Gesundheitswissenschaften unübersehbar – in Richtung junk science.

Kommentare

  1. #1 Thilo
    27. April 2012

    Ich gehöre zwar eigentlich nicht zu den Leuten, die grundsätzlich jeden NS-Vergleich unpassend finden, aber in diesem Fall gäbe es sicher bessere Vergleiche. Das Problem mit Raschers Versuchen liegt doch schließlich auf einer anderen Ebene als der der Wissenschaftlichkeit.

    Ansonsten natürlich volle Zustimmung. Interessant wäre mal zu recherchieren, inwieweit diese Aktivitäten (die ‘Studenten’ und Doktoranden des Instituts zahlen ja wohl hohe Gebühren) vor allem finanziell motiviert sind, also ob sich die Viadrina oder zumindest das Institut in wesentlichen Teilen aus diesen ‘Drittmitteln’ finanziert.

  2. #2 Joseph Kuhn
    27. April 2012

    “Das Problem mit Raschers Versuchen liegt doch schließlich auf einer anderen Ebene als der der Wissenschaftlichkeit.”

    Natürlich sind Raschers Experimente in erster Linie einfach fürcherliche Verbrechen und weniger ein Wissenschaftsproblem. Trotzdem ist man hier genau an dem Punkt, um den es geht: Reicht die Frage nach der Methode alleine, um “Wissenschaftlichkeit” auszuweisen. Es war übrigens eine der Verteidigungsstrategien von Nazi-Ärzten, dass sie sich darauf berufen haben, in anderen Ländern hätte es ähnliche Experimente gegeben, sie hätten doch nur normale Wissenschaft betrieben. Bei Experimenten mit Menschen scheint mir eine Trennung von “Forschung” und “Forschungsethik” nicht ohne Weiteres möglich. Ich hoffe, der Vergleich dominiert jetzt nicht die weitere Diskussion.

    Was die Finanzierung angeht: Ich meine irgendwo gelesen zu haben, dass sich der Studiengang weitgehend aus den Studiengebühren finanziert (10.000 Euro für 4 Semester, plus Zusatzkosten). Aber sicher bin ich nicht.

  3. #3 fj
    27. April 2012

    Wie Thilo finde ich den NS-Vergleich nicht passend; wir bewegen uns hier auf eine doch noch anderen Ebene.

    Ich bin gespannt, was die Landeshochschulstrukturkommission zu diesem Fachbereich der EUV zu sagen hat. (Die Brandenburgische Technische Universität will das Ministerium ja wegen vorgeblich zu schlechter Forschungsleistung ja zumachen und als Gesamthochschule neugründen. Aber hier wird wenigstens noch Wissenschaft betrieben. Was für eine Kur muß sich die Ministerin für den Esoterikbereich einfallen lassen?)

  4. #4 Thilo
    27. April 2012

    10000 Euro ist ja richtig billig. Bei der Freien Universität Teufen mußte man mindestens 20000 Euro zahlen. Die wurde allerdings 2009 dichtgemacht.

  5. #5 Björn Reinhardt
    27. April 2012

    Man, immer diese Nazi-Vergleiche… Schadet dem eigenen Argument. Wirklich!

    Besonders in diesem Fall, in dem es auch noch völlig unangebracht ist.

    Und die Spinner von der Eso-Uni haben einen Punkt an dem sie sich hochziehen könne um nicht über die tatsächlichen gültigen Kritiken an dieser unglaublichen Arbeit sprechen zu müssen.

  6. #6 Hartmut Kaiser
    27. April 2012

    …und schwups …wooohlfüüühlen: Diese Masterarbeit ist eine Fundgrube!

    “…Prof. Walach empfahl mir die Bedeutungsfrage dieser beiden Erlebnisse doch mal im Kozyrev-Spiegel zu stellen. Dies tat ich am gleichen Abend. Ich setzte mich also hinein und stellte mir mein Thema vor: Was bedeuten Motorrad – Resonanzkammer – krank ?? Danach versuchte Gedankenfreiheit und schwupps … lag ich wieder in der Resonanzkammer in der Großen Pyramide. Aber, diesmal lag ich nicht nur so darin, sondern ich erlebte original die Gefühle, welche ich 3 Jahre zuvor in dieser Resonanzkammer hatte (Abb. 2). Diese reine Gefühlsebene läßt sich nicht mit Worten beschreiben (das soll auch Napoleon so ähnlich empfunden haben, erzählte man mir hinterher). Am ehesten umschreiben kann man es vielleicht mit: Aufladen, wie an einem Akku – schwerelos – zeitlos – wooohlfüüühlen.”

    unglaublich komisch oder unglaublich peinlich?

  7. #7 Joseph Kuhn
    27. April 2012

    Nochmal: Hier wird nicht argumentiert, dass Herr Walach etwas macht, was moralisch mit den Nazi-Verbrechen auf einer Stufe steht. Das wäre ja auch absurd. Hier wird vielmehr argumentiert, dass sein Wissenschaftskriterium nicht ausreicht und nicht einmal eine Abgrenzung zu den – ebenfalls als “wissenschaftlich” deklarierten – Menschenversuchen damals aufzeigt.

  8. #8 Spritzpups
    27. April 2012

    Sowas geht als Masterarbeit durch? Ohne Witz?!
    Das liest sich wie ein überlanger Blogeintrag irgendeines Esoterikers. Nicht zu fassen…

  9. #9 rolak
    27. April 2012

    Es kann ja nun wirklich sein, daß meine Auffassung in dem Punkt etwas verquer ist, doch ich sehe im post keinen Nazi-Vergleich. D.h. die berüchtigten Rascher-Experimente werden mit nichts verglichen, sondern nur als offensichtlich abstruser Fall, als Gegenbeleg für Walachs These ‘Methodik ist alles’ herangezogen. Denn da sie diesem Kriterium genügen, ist jedem sofort (und schon intuitiv) klar, daß Walach (mal wieder) ungenaue bis sinnlose bis grundfalsche Statements abgelassen hat, nur um nebelkerzenwerfend seiner und des Institutes wissenschaftliche Existenzberechtigung zu unterstützen.

    Auch hier wurde weder Rascher mit Walach verglichen, noch letzterem Vorsatz unterstellt. Denn wie heißt es so schön: Unterstelle nie Bösartigkeit, wo Dummheit als Erklärung ausreicht.

  10. #10 Enrico Weigelt, metux IT service
    27. April 2012

    Tja, leider hat dieser Artikel auch nichts mit Wissentschaft zu tun. Nur völlig unsachliche Polemik, die sich überhaupt nicht mit dem eigentlichen Thema auseinander setzt.

    Wenn Du belegen möchtest, daß diese Leute unwissentschaftlich arbeiten, dann mußt Du Dich schon aktiv mit deren Arbeiten auseinandersetzen und konkret die Fehler aufzeigen. Andernfalls gibt das einfach nur ein unwissentschaftliches Meinungsbild.

    Im Übrigen halte ich als Informatiker Dinge wie Telepathie für durchaus plausibel. Wir wissen ja alle, daß das Hirn (bzw. das gesamte Nervennetz) ein UWB-Sender ist, und durchaus auch Funksignale empfangen. Bei geeigneter Codierung ist es durchaus möglich, daß relevante Informationen übertragen und anschließend von unterbewußten Prozessen dem Bewußtsein über Träume, Geisteserscheinungen, udgl. visualisiert werden.

  11. #11 rolak
    27. April 2012

    Sorry für die Überschneidung, Joseph Kuhn, doch für jenen schmalen Kommentar benötigte ich eine Viertelstunde, weil immer wieder frustbedingt auftretendes allzu Justiziables umformuliert bis gestrichen werden mußte ;-)

  12. #12 Joseph Kuhn
    27. April 2012

    @ rolak: Danke für die Klarstellung. Genau so war´s gemeint.

    @ Weigelt: Halten Sie Telepathie “als Informatiker” oder als “an Esoterik Interessierter” für plausibel? Kommt Telepathie in Ihrer Arbeit als Informatiker vor?

  13. #13 Thomas Vollmer
    27. April 2012

    Als Beispiel: Prediagnostik – hier wäre in der nicht so weiten Zukunkt enormer Wissenszuwachs möglich. Die dazu betriebene Forschung könnte aller höchsten wissenschaftlichen Standards genügen, trotzdem könnte die Gesellschaft dies als unmoralisch und unethisch ansehen. Defakto war aber nicht die Methode unmoralisch, sondern einzig die Wissenschaftler mit ihrem Handeln.
    “Wissenschaftlichkeit” ist weder gut noch böse. Die Lehre (wohlgemerkt nicht der Lehrkörper!) sollte nicht nach moralischen sondern nach erkenntnistheoretischen Kriterien bemessen werden.
    Ethik und Moral müssen diejenigen haben, die Wissenschaft betreiben. Die Menschen stehen hier in einer Pflicht und auch einzig in der Verantwortung. Wenn ich so darüber nachdenke, so wird dies bei uns im Sprachgebrauch oft einfach gleich gesetzt.

  14. #14 rolak
    27. April 2012

    Heidewitzka, da schlagen hier die cranks auf, wo es doch meineserachtens nebenan wesentlich wahrscheinlicher gewesen wäre…

    Wir wissen ja alle

    Grundfalsch, Enrico: Ganz unbescheiden nehme ich an, daß nicht nur für mich das Gegenteil zutrifft.
    Du hast offensichtlich nicht nur sowohl von der als Vergleich herangezogenen Technik als auch von den Prozessen des Bewußtseins keine Ahnung, sondern erdreistest Dich zusätzlich, das und Deine aus dem A^h^h^hr Luft gegriffenen Folgerungen als Folge Deiner Informatik­aus­bildung auszugeben. Das ist Rufmord an meinem Ausbildungsgang^^

    Daß selbst methodisch sauber arbeitende, hartgesottene Parapsychologen in jahrzehntelanger Kleinarbeit keinen einzigen Beleg für irgendetwas in Richtung Telepathie finden konnten, scheint Deine wahnhaften Phantasien in keiner Weise zu beeinflussen. Da bleibt nur eine Pflichtaufgabe

    Et ceterum adnoto: Form und Inhalt! (© Bullet)

  15. #15 para
    27. April 2012

    Wow– ich habe die Arbeit mal überflogen–und kann nur sagen- wow. Schon der Form wegen hätte mir meine Betreuer sowas um die Ohren gehauen. Eine Definition von “viel” und “wenig” meditativer Erfahrung habe ich nicht gefunden (überlesen?), bei der Statistik auch das www (ohne Datumsangabe) zu bedienen halte ich ebenso für sehr …”gewagt” – das Web ist nicht gerade für langlebigkeit bekannt- ist der Link hinüber wirds mit der Nachvollziehbatkeit schwierig.
    Dann auch noch auf so viel Humbug aufgebaut (Global Scaling, Urformexperimente…)– wenn sowas “hervorragend” ist, bin ich doch ein bisschen neugierig wie schlechte Arbeiten aussehen.

  16. #16 noch'n Flo
    27. April 2012

    @ Enrico Weigelt:

    Im Übrigen halte ich als Informatiker Dinge wie Telepathie für durchaus plausibel.

    Tja, ohne Kenntnisse in Neurophysiologie kann so etwas schnell einmal passieren.

    Wir wissen ja alle, daß das Hirn (bzw. das gesamte Nervennetz) ein UWB-Sender ist, und durchaus auch Funksignale empfangen.

    Also ich weiss es nicht, und ich bin Arzt. Was hat der Herr Informatiker denn bitteschön für Kenntnisse, die der Ärzteschaft bislang unbekannt sind?

    Bei geeigneter Codierung ist es durchaus möglich, daß relevante Informationen übertragen und anschließend von unterbewußten Prozessen dem Bewußtsein über Träume, Geisteserscheinungen, udgl. visualisiert werden.

    Hahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahahaha… nein!

  17. #17 enbeh
    27. April 2012

    Enrico Weigelt

    Wir wissen ja alle, daß das Hirn (bzw. das gesamte Nervennetz) ein UWB-Sender ist, und durchaus auch Funksignale empfangen. Bei geeigneter Codierung ist es durchaus möglich, daß relevante Informationen übertragen und anschließend von unterbewußten Prozessen dem Bewußtsein über Träume, Geisteserscheinungen, udgl. visualisiert werden.

    Wusste ich nicht. Dabei dachte ich, beim Gehirn würde ich mich halbwegs auskennen. Entschuldigen Sie meine naive Frage, aber wie soll denn das gehen bei den winzigen Strömen, die an der Zellmembran von Nervenzellen fließen? Und wie soll das Gehirn Funksignale empfangen? Ich vermute, Sie sprechen jetzt nicht von Elektrosmog, der das Nervensystem beeinflusst, sondern tatsächlich vom Kommunikation? Und falls das alles funktionieren sollte (wäre ja eine tolle Sache, auch evolutionär und so), warum funktioniert es dann nicht einfach bewusst wie normale Kommunikation auch, sondern erfordert Träume und Geistererscheinungen?

  18. #18 Hartmut Kaiser
    27. April 2012

    Dieser Studiengang ist ein Geschäft, bei dem alle Seiten profitieren, mit Ausnahme der Patienten, die dann auf die so Ausgebildeten hereinfallen.

    Die Stifter: Die Homöopathie-Pharmafirma Heel stiftet eine Professur, erreicht dadurch Verankerung unwissenschaftlicher Konzepte in der akademischen Welt, den Anschein größerer Seriosität und pflegt über die Absolventen den Absatzmarkt seiner Produkte.

    Professor Walach und die anderen Dozenten: Dürfen akademisch geweiht, ihren Bullshit verbreiten, machen nebenbei Werbung für ihre eigenen in der Pseudomedizin und Esoterik angesiedelten Unternehmungen.

    Die Teilnehmer des Studienganges: zahlen zwar 10000€, müssen aber nur selten präsent (min. 12 Tage/ Semester an Wochenenden) sein und erhalten dann Fortbildungspunkte und, gegen Abgabe solch peinlicher Texte, klangvolle Titel, mit denen sie ihre Patienten beeindrucken können. Letztlich ermöglicht ihnen das eine effektivere Befischung der seichten aber ertragreichen Gewässer abseits der Kassenleistungen.

  19. #19 MJ
    27. April 2012

    Nach welcher Ausformung von Wissenschaftstheorie ist den eine “gute Methodik” das “einzige Kriterium” für Wissenschaft? Ich weiß nicht, irgendwie kommt es mir vor, dass da oft nicht nur Pseudo-Wissenschaft betrieben wird, sondern das ganze dann auch noch mit Pseudo-Wissenschaftstheorie untermauert wird: man nehme lose ein paar Begriffe, die der Allgemeinheit bekannt sind (“Methode”, “Falsi-nuschel-barkeit”, “Intersubjektivität”, “Sörkerl Popa”) und das passt dann schon irgendwie. Ist das die neue “Methode” nach Mickey Mouse: zuerst irgendwelche Daten gewinnen und dann sehen, ob sich das mit einer “Theorie” vereinbaren lässt, die selbst keinerlei Fundament hat? Der Mensch hat in Philosophie und Geschichte promoviert – da ist nicht erst was mit der Viadrina falsch gelaufen, sondern schon wesentlich früher, etwa als er die Einführungsvorlesung bestanden hat (und Verzeihung, das soll jetzt wirklich kein blöder Anwurf sein, aber es deckt sich mit meinem Eindruck, wie extrem niedrig die Standards in manchen geisteswissenschaftlichen Studiengängen ist, um dort irgendwie zu einem Titel zu kommen…).

  20. #20 Ponder
    27. April 2012

    Hier gibt’s noch eine -bzw Auszüge daraus:

    http://www.my-quantec.cl/de/pdf/025_dt_Heuschnupfen.pdf

    Viel virtuelles und weißes Rauschen – Patienten-und Medikamentenfotos gespeichert in der Quanten-Cloud…. oder so… Wer es fassen kann, fasse es…!

  21. #21 Dr. Webbaer
    27. April 2012

    Offenkundig ist den Beteiligten das Gefühl dafür abhandengekommen, was Wissenschaft ist und was nicht.

    Dieses ‘abhandengekommene Gefühl’ ist in manchen Fachgebieten die Voraussetzung der Beschäftigung.

  22. #22 Dr. Webbaer
    27. April 2012

    Demnach könnte man auch die Unterdruckexperimente des SS-Arztes Rascher im KZ Dachau als gute Wissenschaft durchgehen lassen. Irgendetwas fehlt offensichtlich in Walachs Bestimmung des Wissenschaftlichen.

    Der Witz ist ja, dass NS-Vergleiche gar nicht – wie in Doitschland oft fälschlicherweise angenommen – per se ungünstig sind, sondern dass erfahrungsgemäß oft beim Vergleichenden die Intelligenz gefehlt hat den passenden Vergleich anzulegen.

    MFG
    Dr. Webbaer (der sich hier also nicht im geringsten aufregt, nicht einmal über diejenigen, die reflexartig aufgezeigt haben)

  23. #23 Joseph Kuhn
    27. April 2012

    @ Ponder: Danke für den Link. Auch das ist eine Masterarbeit gewesen, die Kozyrev-Arbeit war also kein Einzelfall.

  24. #24 Joseph Kuhn
    27. April 2012

    … und wenn man einmal anfängt: Hier ein Bericht über eine Diplomarbeit zum Fernheilen, von Herrn Walach noch in seiner Freiburger Zeit betreut:
    http://www.bpv.ch/content/texte/geistiges-heilen-wiesendanger-studie-fernheilen.html
    Möglicherweise hat man ihn in Frankfurt/O. also sehenden Auges berufen, was dann auch ein Teil der Erklärung wäre, warum er dort mit solchen Arbeiten durchkommt.

  25. #25 MJ
    28. April 2012

    hmmm… Ich nehme das da oben zurück. Wenn ich keine blöden Anwürfe machen will, sollte ich es vielleicht einfach nicht tun. Geisteswissenschaftliche Studien sind anders organisiert, und ich sollte nicht auf Basis persönlicher Eindrücke Dinge kritisieren, die ich selbst nicht gemacht habe…

  26. #26 Ponder
    28. April 2012

    @ Joseph Kuhn:

    Als Hintergrundinformation zur CAM-Szene auf dem Weg durch den Bologna-Prozess ist vllt auch dieses DOC interessant:

    http://www.carstens-stiftung.de/media/files/artikel_bilder/seminarkongress_lehre/von_Ammon.pdf

    Die Viadrina-Konstruktion im ursprünglichen Zustand und mit ihrer Verbindung zur Oberberg-Akademie und anderen ähnlich gestrickten Gebilden erweckt bei mir den Anschein, als ob hier ein niederschwelliges universitäres Angebot geschaffen werden sollte, welches letztlich auch nichtakademischen Berufen – womöglich sogar Heilpraktikern – den Zugang zu einem akademischen Grad verschaffen könnte.

  27. #27 Joseph Kuhn
    28. April 2012

    @ Ponder:

    Mit http vorne dran sind die links anklickbar. Kleiner Service ;-)

    Danke für das Dokument. Was daran u.a. deutlich wird, ist die strategisch klug angelegte Einbettung esoterischer Angebote in einen breiteren “komplementärmedizinischen”, “salutogenetischen” bzw. “präventiv orientierten” Rahmen, um Akzeptanz zu gewinnen. Unter den Naturheilverfahren beispielsweise gibt es ja durchaus sinnvolle und wirksame Verfahren, die Salutogenese ist ein seriöses Konzept, die Prävention muss sicher ausgebaut werden. Indem sich die esoterischen Angebote in diesem Geleitzug bewegen, profitieren sie vom Wunsch vieler Menschen nach einem nicht auf bloße “Organreparatur” beschränkten Umgang mit der Gesundheit. Nur – dazu braucht es keine Esoterik, das war gewissermaßen Standard der hausärztlichen Praxis und viele Hausärzte versuchen, das auch unter den heutigen ökonomischen Rahmenbedingungen zu realisieren. Über Einseitigkeiten und Fehlentwicklungen der Medizin bzw. unseres Umgangs mit dem Thema Gesundheit allgemein wird ja auch in vernünftigen Kreisen durchaus kritisch diskutiert und die Esoterik ist bestimmt keine Antwort auf diese Probleme. Aber es gelingt ihr ganz gut, so aufzutreten, das verlinkte Papier ist ein Beispiel dafür.

  28. #28 Alexander Schmidt
    28. April 2012

    Diese Universität scheint es auf naive Gemüter abgesehen zu haben. Von denen gibt es ja genug. Esoterik und magisches Wunschdenken haben ja leider eine Renaissance erfahren. Anstelle diesen Rückschritt im Denken auch als solchen zu erkennen, zelebriert man die Dummheit und bedient sich gleichzeitig aus Profitinteressen dem allgemeinen Hype (der dadurch noch verstärkt wird).

    Erschreckend ist hierbei vor allem, mit welcher Dynamik sich hier Schwachsinn und Quacksalberei nach und nach in Universitäten einschleichen. Diese produzieren dann Titelträger mit vermeintlicher Autorität und gefährden so die Basis der Wissenschaft selbst. Denn wenn die Masse der Idioten erst einmal eine kritische Masse erreicht, dann befindet sich die Menschheit in höchster Gefahr. Die Unterwanderung der Wissenschaft durch Vollidioten muss verhindert werden.

    Das ist so ein bisschen wie mit den Nazis damals. Erreicht man eine kritische Masse an Vollidioten, dann ist das Land dem Elend geweiht. Insofern finde ich den obigen NS-Vergleich gar nicht so unpassend. Dumme erkennen nicht, dass sie dumm sind. Denn dafür sind sie zu dumm. Und leider neigen Dumme auch zu Selbstüberschätzung und Rechthaberei, ohne sich dabei an Fakten zu orientieren.

    Das einzig probate Mittel gegen Dummheit ist ordentliche Bildung. Aber was macht man, wenn die Bildung selbst verwässert wird? Siehe Nazis. Wie erklärt man einem Nazi, dass die NS-Ideologie dumm ist, wenn die Ideologie bereits alle Fakten durch Dogmen ersetzt hat? Die Viadrina erinnert mich an Bücherverbrennungen. Man ignoriert ganz gezielt die Realität und versucht sie zu ersetzen mit Wunschdenken.

  29. #29 Joseph Kuhn
    29. April 2012

    @ Alexander Schmidt: Das Grundgesetz schützt die Freiheit von Forschung und Lehre. Das funktioniert nur, wenn dieser Schutz recht weitgehend ist. Leider wird so auch viel Nonsens geschützt, die Möglichkeiten einer “akademischen Qualitätskontrolle” sind begrenzt. Vor einer “kritischen Masse an Vollidioten”, die das Land ruinieren, muss man vermutlich dennoch keine allzu große Angst haben, unser Wissenschaftssystem scheint mir insgesamt recht robust und es hält einen Walach ebenso aus wie manch andere akadamische Problemfälle, aber das Wissenschaftssystem muss solche Fälle aufarbeiten und daran immer wieder seine Kritierien und Maßstäbe schärfen. Weggucken ist keine Lösung. Der Fall Guttenberg zeigt das ja zur Genüge.

  30. #30 Dagda
    29. April 2012

    @ Joseph Kuhn

    Bei Experimenten mit Menschen scheint mir eine Trennung von “Forschung” und “Forschungsethik” nicht ohne Weiteres möglich. Ich hoffe, der Vergleich dominiert jetzt nicht die weitere Diskussion.

    Selbst wenn man Forschungsethik und Forschung sauber trennen könnte, ist methodisch sauber durchgeführte unethische Forschung (meinetwegen die Tuskegee-Studie, wenn man “Nazi-Vergleiche” ablehnt) keine gute Wissenschaft.

  31. #31 ed2murrow
    29. April 2012

    Ihr Artikel, lieber Joseph Kuhn, fügt dem ursprünglichen Nonsens der sog. Masterarbeit noch den hinzu: “die „Kozyrev-Theorie” sei zwar „abgedreht”, aber die Masterarbeit beschreibe „ein relativ pfiffiges Experiment”. Daher würde die Arbeit demnächst auch einem peer-reviewten Journal vorgelegt.”

    Das entspricht, summa summarum, dem Aggregatzustand^^ von “intelligent design” und deren “wissenschaftlicher Methode”, vgl. http://de.wikipedia.org/wiki/Intelligent_Design#Intelligent_Design_und_die_wissenschaftliche_Methode . Das ist offensichtlich Walach auch bekannt, der folgerichtig auf die nächste Stufe springt, http://de.wikipedia.org/wiki/Intelligent_Design#Peer_Review

    Ist sie nicht schön, diese stoffliche Nähe?

    Btw: Godwins Law brauche ich hier nicht. Es reichen mir diverse Bildungsminister, die Darwin et al. im Religionsunterricht, dafür das erste Buch Genesis im Biologieunterricht vermittelt sehen wollen.

  32. #32 Dagda
    29. April 2012

    Hä?
    Ich bin mir nicht sicher ob sie den Artikel verstanden haben. Worauf wollen sie dann mit Godwins Law hinaus?

  33. #33 ed2murrow
    29. April 2012

    Gesundheit!@ Dagda
    Haben Sie letzthin mal in die Zeitungsverkaufsschale Ihres Vertrauens geguckt? Warum “Zwillingsforschung so wichtig” sei? Brauch ich dazu wie zu dem Esoterikmist an der Viadrina den Nazivergleich? Gewiß nicht, ganz im Gegenteil – den kühlen Kopf.So pflege ich auch Artikel zu lesen, die ich kommentiere.
    Beste Grüße, e2m

  34. #34 Joseph Kuhn
    29. April 2012

    @ ed2murrow: Die Frage, ob es hier um einen “Nazivergleich” geht, wurde oben schon diskutiert und von mir auch noch einmal klarstellend kommentiert.

    Was das von Walach angekündigte Peer Review angeht: Das ist so gut oder so schlecht wie die Gutachterauswahl. Der Phantasie sind hier wenig Grenzen gesetzt.

  35. #35 ed2murrow
    29. April 2012

    @ Kuhn
    Danke für Ihre Antwort.
    Wenn ich Ihr Zitat richtig verstehe, will Walach “einem peer-reviewten Journal” vorlegen. Die Frage dürfte sich stellen, ob es ein Journal gibt und wenn ja, welcher Art, das tatsächlich Aufwendungen für ein derartiges, nennen wir es: Thema erbringt. Dass es “Journaille” in der Hinsicht gibt, steht spätestens seit psychophysik und der Lobhudelei an Walach außer Frage. Das so etwas nach peer-review arbeiten würde, wäre eine echte Schlagzeile.
    Beste Grüße, e2m

  36. #36 Joseph Kuhn
    30. April 2012

    @ ed2murrow: Ein Kandidat wäre z.B. die Zeitschrift “Forschende Komplementärmedizin”. Die Zeitschrift ist peer reviewed, Herr Walach ist chief editor. Die “Zeitschrift für Anomalistik” ist nach eigenen Angaben ebenfalls peer reviewt. Die Publikationsmöglichkeiten dürften aber auch darüber hinaus recht gut sein, siehe Walachs Publikationsliste, die mit seinen Publikationen in peer reviewten Zeitschriften beginnt.

    Grundsätzlich ist gerade bei der Untersuchung von “ungewöhnlichen Phänomenen” das Einreichen bei einer peer reviewten Zeitschrift auch der richtige Weg. Nur muss das peer review gut und kritisch sein. Es darf bei aller natürlich immer gebotenen Offenheit für Ungewöhnliches nicht vom Wunsch bestimmt sein, ungewöhnliche Erklärungsansätze für ungewöhnliche Phänomene zu rechtfertigen – eines von vielen Problemen der hier diskutierten Masterarbeit.

  37. #37 G.W.
    30. April 2012

    Kostproben aus der Arbeit

    S. 30
    Bei “nichtklassischen Pseudomaschinen” ist eine Separation physikalischer
    und psychologischer Variablen nicht eindeutig möglich. Es herrscht
    Entanglement. (Verschränkung, d.A.) (Lucadou 2002)

    Die empirische Signatur nichtklassischer Pseudomaschinen:
    - Experimentelle Daten sind meist nicht replizierbar
    - Die Effekte oszillieren
    - Bei Verblindung verschwinden die Effekte ! Dies ist ein deutlicher Hinweis auf
    Eine “nichtklassische Pseudomaschine“. (Walach 2010)

    Trotzdem treten starke Effekte auf, welche phänomenologisch nicht bestreitbar
    sind. Ihre Zuverlässigkeit läßt meist eine praktische Anwendbarkeit zu.
    “Pseudotheorien” machen eine klassische Erklärung möglich.

    S. 31
    Fündig werden wir bei der Generalisierten Quantentheorie (GQT, auch Weak
    Quantum Theory – WQT), welche eine Erweiterung der Quantentheorie (QM)
    auf Systeme außerhalb der Quantenwelt zuläßt. Dazu werden diejenigen
    Randbedingungen, welche die QM auf die Quantenwelt beschränken (wie
    Plancksches Wirkungsquantum), fallengelassen.

    S. 32
    Beispiele aus der GQT wären: Individualität – Gemeinschaft
    Diagnose – Therapie
    Ergebnis – Prozeß
    Materie – Geist
    Offenheit – Unbewußtheit (Walach: GQT)

    S. 33
    5) Die zusätzliche Abdeckung der Spiegel für den Probanden (und den
    Versuchsleiter) bedeutet hier eine Verblindung im Versuch und läßt die
    Verschränkung zusammenbrechen –> sehr starkes Indiz für “nichtklassiche
    Pseudomaschine”.
    Im verdeckten Versuch müßte der Spiegel im verschränkten Zustand sich
    selbst zu erkennen geben, d.h. zumindest ein Ja/Nein-Signal: bin Spiegel oder
    nicht. Damit erfolgt ein Verstoß gegen das Axiom “keine Signalübertragung”
    und die Verschränkung bricht zusammen.
    6) Viele Bedingungen der “nichtklassischen Pseudomaschinen” bzw. der GQT
    beschreiben Verläufe über mehrere Versuchsreihen. Da meine Testungen den
    Charakter einer Pilotstudie haben, sind diese derzeit noch nicht überprüfbar.
    Die überprüfbaren Fakten jedoch lassen den Schluß zu, daß ein Kozyrev-
    Spiegel sich den “nichtklassischen Pseudomaschinen” zuordnen läßt.

    S. 34
    Einerseits haben in den letzten 2 Jahren die im Internet, bei gezielter Suche,
    auffindbaren Artikel mit Bezug zu Kozyrevs Arbeit deutlich zugenommen.
    Andererseits werden diese Erkenntnisse weder in der etablierten noch in der
    populären Wissenschaft überhaupt wahrgenommen, nicht einmal mit einer
    Randnote erwähnt oder als Pseudotheorie abgetan.

    S. 35
    ZEIT ist eine unabhängige physikalische Entität
    - besitzt Energie
    - überträgt Information
    - hat Geschwindigkeit – und zwar alle möglichen von 0 bis Unendlich
    - besitzt eine Dichte
    - wirkt ektropisch und damit schöpferisch

    S. 36
    Einerseits lösen sich Begriffe wie Äther, Nullpunktenergie, morphogenetische
    Felder, Akasha-Chronik, feinstoffliche Felder oder Energien, Dunkle Materie
    und Dunkle Energie als Synonyme für ZEIT(-Energie) auf.
    Andererseits stelle ich die Hypothese auf, dass (nahezu?) ALLE “missing links”
    der heutigen Wissenschaften auf eine fehlende Einbeziehung der ZEIT
    (natürlich meine ich jetzt nicht die lineare Zeit) zurückzuführen sind.

    S. 41
    Die kreisförmige Darstellung der Dimensionen erscheint mir sympathischer, da
    mir eine lineare Begrenzung ebenso sinnlos erscheint, wie eine lineare
    Unendlichkeit. Und letztlich ist doch alles irgendwie ein Kreislauf.

    Das andere Ende der Dimensionskala wäre die Annäherung an den Nullpunkt
    von der materiellen Seite. Ein kleinstmögliches Raummaß – als infinetisimale
    Annäherung an den Punkt – stellt Burkhard Heim mit dem “Metron” vor.
    Das Metron als Quadrat der Planck´schen Länge (ca. 1,6 x 10-35 m) kann man
    sich wie ein winziges Blatt Papier vorstellen: biegsam, faltbar oder auch
    zusammengeknittert erreicht es so Raumausbreitung. Aus diesen kleinsten
    Raumteilchen kondensiert alle Materie – infolge von Ereignissen, die, wie im
    vorigen Absatz dargestellt in den oberen Dimensionen “geplant” und “kreiert”
    werden.

    S. 42
    Persönliche Abschlußbemerkung
    Ich habe lange mit mir gerungen, ob ich meine persönlichen Vorstellungen
    eines Funktionsmodells unserer Umwelt hier darstellen soll.
    Aber wo, wenn nicht hier, kann ich dieses zur Diskussion vorstellen ?

    Kommentar meinerseits
    - Die tiefgreifenden Erkenntnisse und Überlegungen rufen nach den Nobelpreisen für Physik, Chemie und Medizin.
    - Die Generalisierte Quantentheorie ist ohne „Formalismus“ in irgendeinem wissenschaftlichen, operationalisierbaren Sinne. Sie verdankt sich offenbar alleine populärwissenschaftlichen Darstellungen der Quantentheorie. Es gibt dafür keinerlei Belege. Im Gegenteil, ubiquitäre Phänomene wie die Dekohärenz entziehen ihr den Boden.
    - Die Auswertung ist naiv. Die Multiplizität der Tests wird nicht berücksichtigt, ferner erfolgt keine Varianzanalyse, welche dem Design angemessener wäre.
    - Die Interpretation der Daten folgt der Linie, dass verblindete Experimente qua „Theorie“ scheitern müssen. Mehrfache Verblindung ist aber die einzige Methode einer objektivierbaren Überprüfung.

  38. #38 zwecke
    30. April 2012

    Walach hier beim promoten der verantwortungslosen, manipulativen Pseudodokumentation „Am Anfang war das Licht“

    Ganz nach unten scrollen, letztes Video
    http://www.amanfangwardaslicht.at/naturwissenschaft.html

    O-Ton Walach:
    „Wenn wir uns anschauen, dass es eben Leute gibt, die offensichtlich ohne Nahrung leben können…“

    Dem naiven Leser (dem das etwas distanzierende „wir“ nicht auffällt) scheint’s, dass dieser Univ. Prof. Dr. Harald Walach (wie es unter dem Video freilich gekennzeichnet ist) Lichtnahrung ebenfalls für gegeben/real existierend hält.
    Ebenso wie Straubinger, auch Walach doch egal, wenn jemand so naiv ist, diese manipulative Lichtnahrungs-Inszenierung für bare Münze zu nehmen, nachzuahmen und seine Gesundheit zu beschädigen oder gar sein Leben dadurch zu zerstören.

    Walach leistet Großartiges bei der Verbreitung vom scheinwissenschaftlich fundierten Aberglauben in der Gesellschaft. Es ist mir ein Rätsel, warum keiner diesen Mann stoppt.

  39. #39 Fliegenschubser
    30. April 2012

    @ G.W. : Danke für die Auszüge aus der Arbeit. Ich weiß nicht, ob ich heulen, lachen oder kotzen soll. Das ist schlicht …hm…mir fehlen die Worte. Mein Gehirn tut weh. Aua.

  40. #41 rectus
    30. April 2012

    @ G.W.

    – Die tiefgreifenden Erkenntnisse und Überlegungen rufen nach den Nobelpreisen für Physik, Chemie und Medizin.

    Zumal ja bisher sogar die Lichtgeschwindigkeit in der gesamten wissenschaftlichen Literatur um den Faktor 3600 falsch dargestellt ist. Seite 6:

    Das ergibt für c2 einen numerischen Wert von ca. 2200 km/h oder
    0,73 % der Lichtgeschwindigkeit.

    Wobei die Textauszüge unter dem Motto “man kann Schlurz prinzipiell nicht nachweisen; da man Schlurz nicht nachweisen kann, existiert Schlurz” natürlich viel lustiger (trauriger) sind.

  41. #42 Dr. Webbaer
    30. April 2012

    @Dagda
    Was erwarten Sie von einer UN-Institution?

  42. #43 G.W.
    30. April 2012

    @Fliegenschubser

    Meine dringende Empfehlung der Gesundheit wegen: lachen

    Die Implikationen sind ebenso nichtig wie gewaltig. Nichtig u.a. deshalb, weil es eines ebenso speziellen wie auch wieder beliebigen Aluminiumzylinders (keine Präzisionsarbeit auf optischem Interferenzniveau, „basteln“ heißt es in der Arbeit) bedarf, um das Phänomen überhaupt „nachzuweisen“.

    Gewaltig, weil das eigentliche ja die Theoretische Physik angeht. Unentdeckte Kräfte, neuartige Raumzeitkonzepte usw. Nach meiner Meinung sollte man die Arbeit unbedingt denen mitteilen, die beispielsweise an Superstringtheorie und vor allem an Quantenschleifengravitation arbeiten. Jemand sollte es übernehmen, sie an Lee Smolin, Carlo Rovelli, Martin Bojowald, Claus Kiefer usw. zu senden, damit die neue Ideen bekommen. Die Kerle verlieren sich ja sonst in Mathematik, wo doch ein mit Alufolie beklebter Zylinder reicht.

    Was aber vom akademischen Standpunkt besonders beeindruckt, ist der meisterliche Stil dieser Masterarbeit. „Three quarks for Muster Mark“ heißt es in James Joyce’s „Finnegans Wake“. Von da nahm Murray Gell-Mann nach eigener Behauptung die Bezeichnung „quark“. Und bei Goethe heißt es im „West-östlichen Divan“: „Getretener Quark wird breit nicht stark“. Was sagt uns das, wenn nicht, dass Master, Östliches, quarks und Quark zusammenhängen? Das hat auch für die Milchwirtschaft Konsequenzen und könnte Thema einer weiteren Masterarbeit sein.

  43. #44 Joseph Kuhn
    30. April 2012

    @ Zwecke:

    Danke für den Link zu dem kleinen Film mit Herrn Walachs Interview zur Lichtnahrung. Er schreckt ja wirklich vor nichts zurück.

    Der Film ist trotz seiner Kürze ganz aufschlussreich. Walach beginnt das Interview mit einer interessanten rhetorischen Figur: Entweder man sage, so etwas wie Lichtnahrung sei Unfug oder man sehe das als “Anomalie”, das öffne dann den Weg zu neuen Erklärungsmodellen, so funktioniere wissenschaftlicher Fortschritt. Walach führt hier eine Scheinalternative ein. Gerade die wissenschaftliche Beschäftigung mit “ungewöhnlichen Phänomenen” muss in der Lage sein, Unsinn als Unsinn auszusondern (oder etwas offener: Irrtum als Irrtum), daran bemisst sich ja wissenschaftlicher Fortschritt, und nicht daran, sich mit allem abzugeben.

    Seine Ausführung zum wissenschaftlichen Fortschritt ist ebenfalls interessant. Er sagt, wissenschaftlicher Fortschritt funktioniere immer so, dass man von den “Rändern” aus weitergehe und dass Anomalien dabei eine wichtige Funktion spielen. Das ist so richtig wie trivial. Natürlich wäre der wissenschaftliche Erkenntnisgewinn begrenzt, wenn man sich noch einmal ansieht, welche Ionen bei der Elektrolyse des Wassers entstehen, es kommt vermutlich mehr dabei heraus, wenn man ungewöhnliche Beobachtungen im Teilchenbeschleuniger untersucht. Aber der wissenschaftliche Fortschritt ist auch an den “Rändern” meist ein schrittweiser, es ist kein Prozess, bei dem ständig die Fundamente der Physik revolutioniert werden oder gar ein großer Teil des bisherigen Erkenntnisstands gleich mehrerer Wissenschaften auf einmal über den Haufen geworfen wird. Walach beschreibt den Wissenschaftsprozess mit diesem “Rändermodell” so unspezifisch, dass die Esoterik gut unter die Decke dieser – wie gesagt richtigen, aber trivialen – Bemerkungen schlüpfen kann. Die “schwache Quantentheorie” scheint mir eine ähnliche Funktion zu erfüllen: durch Unspezifität alles zuzulassen.

    Dem guten Mann ist offensichtlich das Gefühl dafür verloren gegangen, was an seltsamen Phänomenen zu untersuchen wissenschaftlich sinnvoll ist, unter welcher Fragestellung man die jeweiligen Phänomene untersuchen sollte, wie man dann die Untersuchungsbefunde im Lichte des wissenschaftlichen Erkenntnisstands interpretieren sollte und was man von vornherein als “Unfug” zur Seite legen kann. Dass man sich dabei irren kann und etwas zum Unfug erklärt, was bei genauerer Betrachtung doch keiner ist, gehört “zum Geschäft”, davon ist die Wissenschaftsgeschichte voll, aber das rechtfertigt nicht jeden esoterischen Unfug.

    Das Ganze wird noch irritierender, wenn man Walachs Ausführungen zu Ockhams Rasiermesser hier in diesem Text zur schwachen Quantentheorie liest. Die ersten 8 Seiten dieses Textes zeigen, dass er sich der Probleme seines Forschungsfeldes durchaus bewusst ist. Aber seine Forschungspraxis sieht ganz anders aus.

  44. #45 Joseph Kuhn
    30. April 2012

    @ Dagda:

    “Was ist eigentlich mit der WHO los?”

    Wie man die verlinkte “Beijing-Declaration” der WHO einzuordnen hat, weiß ich nicht, das müsste man recherchieren. Einen Freibrief für medizinische Anwendungen des “Kozyrev-Spiegels” würde ich jedenfalls nicht darin sehen.

  45. #46 G.W.
    30. April 2012

    Mir scheint, die generalisierte Quantentheorie ist ein Sesam-öffne-dich. Man kann damit die Quantentheorie verbal beerben inklusive der einführenden elementaren Heuristik und zugleich durch die (aus erkenntnistheoretischen Gründen) strikt nichtmathematische Formulierung jede Ausweitung zulassen. Da die Quantentheorie per se durch ihren schlecht definierten ontologischen Status „anomal“ ist, ist sie für Anomalistik ideal geeignet.

    Vom Planckschen Quantum kann theoretisch auch ein direkter Weg zum täglichen Quantum Schnaps führen. Letzterer wirkt in der Regel, ist also ebenfalls ein Wirkungsquantum. Ferner ist er mit einer Unschärferelation verbunden, unter anderem sogar einer von Energie und Zeit: man erinnert sich z.B. später um so weniger, je höher die Energie war, und die vielen Ideen, die man hatte, an die man sich aber nicht mehr erinnert, entsprechen den virtuellen Interaktionen bzw. Teilchen im Feynman-Diagramm. Andererseits kann die Unschärferelation auch aufgehoben werden (wie in der Arbeit in der Einleitung angedeutet), wenn beispielsweise an einem Laternenpfahl Ort und Geschwindigkeit beide zugleich definite Werte haben. Was will man mehr?

    Dass die Nullpunktsenergie (was immer damit physikalisch gemeint ist) und die viel beschrieenen morphogenetischen Felder sich in eins auflösen sollen, ist mir ziemlich unklar. Auch unterscheiden Astrophysiker m.W. zwischen dunkler Materie und dunkler Energie. Letztere versuchte man mit der Vakuumenergie von Quantenfluktuationen zu identifizieren, leider liegen viele, viele Größenordnungen dazwischen. Aber auf Kleinigkeiten wie 50 oder 100 Zehnerpotenzen kommt es bei großen Würfen sicher nicht an.

    Sicher ist es ein interessantes Konzept, dass die Zeit (oder ZEIT) eine Geschwindigkeit hat. Man kann das natürlich über eine Hierarchie von Zeiten behaupten wollen, allerdings muss dann eine der Zeiten absolut sein, wenn es nicht einen unendlichen Regress geben soll. Auch wäre es schön, einmal zu sehen, wie sich das in beispielweise Wirkintegrale, Hamiltonformalismen usw. mathematisch umsetzt und außer über Zylinder mit Haushaltsalufolie nachzuweisen ist.

    Ferner fragt man sich, was denn bei dem generalisiert quantenmechanischen Paar „Diagnose – Therapie“ als Analogon des planckschen Wirkungsquantums fungiert. 1$? Von Interesse ist auch das „komplementäre“ Paar „Offenheit – Unbewusstheit“ Soll das heißen, dass gerade die unbewussten Phänomene der besagten Art nicht mit „Offenheit“ einhergehen?

    Usw. usw. Fragen über Fragen, also ein spannendes Forschungsgebiet.

  46. #47 Joseph Kuhn
    30. April 2012

    @ G.W.:

    Was haben Sie gegen Haushaltsalufolie als letztem Schrei der Experimentalphysik einzuwenden? Schließlich schlagen andere die Steuererklärung auf dem Bierdeckel vor. Das sieht mir nach einem weiteren Verschränkungsphänomen aus und das könnte man, zusammen mit der von Ihnen oben schon vorgeschlagenen milchmädchenwirtschaftlichen Arbeit auch einmal näher untersuchen. Schließlich vollzieht sich wissenschaftlicher Fortschritt vom Denkrand aus. Jetzt muss sich nur noch jemand finden, der die entsprechenden Masterabeiten bei Herrn Walach einreicht, er wird sie ja wohl nicht aus einem bornierten Positivismus heraus als “Unfug” ablehnen.

  47. #48 G.W.
    30. April 2012

    @Joseph Kuhn

    Danke für Ihre Antwort. Sie schreiben, dass sich wissenschaftlicher Fortschritt vom Denkrand aus vollziehe. Das Denken ist aber eine Kugel, die mit einer Birne verschränkt ist. Beide kennen keinen Rand und haben die gleiche Topologie, wenn auch unterschiedliche Geometrie, was uns zu denken gibt. Alufolie stört diese Verschränkung. Das ist der Grund, weshalb man normalerweise keine Birnen in Alufolie sieht, die Menschen haben das intuitiv begriffen. Wohl aber gibt es beispielsweise gebackene Kartoffeln in Alufolie. In der Tat, quantenmechanische Superpositionen zwischen gebackenen Kartoffeln und Birnen treten normalerweise nicht auf (außer in seltenen Anomalien), und man erkennt, ob man eine gebackene Kartoffel oder eine native Birne vor sich hat. Man sagt ja auch, dass jemand (d.h. sein Kugeläquivalent) nicht richtig in der Birne sei, aber nicht, dass jemand nicht richtig in der gebackenen Kartoffel sei. So passt also alles zusammen, und ich hoffe, mich klar ausgedrückt zu haben. Vielleicht nehmen Sie dies sogar zum Anlass, fürderhin in diese offenen Geheimnisse tiefer birnen-, jedoch auf keinen Fall kartoffelmäßig einzutauchen. Freundliche Grüße

  48. #49 Joseph Kuhn
    30. April 2012

    @ G.W.: Ich sehe, Sie bringen den nötigen Ernst für die Fundamentalontologie der Alufolie auf. Wir sollten bei Gelegenheit gemeinsam das überfällige Grundlagenwerk über die Alufolie in ihrer zeittransformalen Bedeutung für die Kartoffel unter Berücksichtigung des Durchmessers des Denkrands schreiben. Herrn Walach bitten wir dann um eine Rezension.

    Jetzt habe ich immerhin ein Blogthema für den nächsten 1. April.

  49. #50 noch'n Flo
    30. April 2012

    @ G.W.:

    Apropos Kartoffeln – niemals vergessen: das Volumen subterrarer Agrarprodukte steht in reziprokem Verhältnis zur geistifen Kapazität ihrer Erzeuger (oder vereinfacht: die dümmsten Bauern ernten die grössten Kartoffeln).

  50. #51 G.W.
    30. April 2012

    @Joseph Kuhn

    Wir werden sehen. Als Vorarbeit habe ich schon einmal versucht, die Daten zu reproduzieren. In Kürze dies: Ich führte den Versuch 5x bei mir durch, stand aber dabei auch 10x jeweils dreifach neben mir. Macht insgesamt 20x. Ferner alterte ich in der Zeit, und meine Persönlichkeit änderte sich. Das ist so gut wie 20 verschiedene Versuchspersonen. Leider konnte ich mein Geschlecht in so kurzer Zeit nicht ändern, das ist und bleibt ein Schwachpunkt der Arbeit. Immerhin gewann ich meditative Erfahrung insofern, als ich immer mehr von allen Gedanken an den Sinn des Versuches Abstand nahm.

    Ferner musste ich Versuchsleiter und Versuchsperson in einem machen. Mit Hilfe von Ockham’s Beil (asini non sunt multiplicandi praeter necessitatem) gelang mir jedoch eine passende Persönlichkeitsspaltung. Ich hoffe, Sie können mir noch folgen. Als Zylinder konnte ich nur 4 Gläser passender Größe nehmen, die ich in der Schnelle mit Alufolie auskleidete, in die vorher Leberkässemmeln verpackt waren.

    Leider entsprach das Ergebnis nicht den Erwartungen und ähnelte dem zeitweise ungeliebten Zufall. Ich vermute, dass hier negative Ausstrahlungen des süßen Senfes, dessen Geruch man an der Alufolie noch erahnen konnte, die Verschränkung zerstörten. Wir wissen ja, dass die Geruchsnerven auf kürzestem Wege ins Gehirn führen. Mein Befund kann erklären, warum Esser von Leberkässemmeln bisweilen weniger einfühlsam und intuitiv erscheinen. Bezeichnenderweise war der Wissenschaftstheoretiker Stegmüller, welcher der Intuition ziemlich abhold war, Professor in München; sicher aß er auch Leberkässemmeln.

    Gleichwohl erhielt ich ein wichtiges ballistisch signifikantes Ergebnis (Signifikanzlevel d<0,05 m). Eines der Gläser fiel um und zerbrach trotz winziger Fallhöhe. Als ich probeweise die anderen Gläser auch umwarf, blieben sie heil. Es kann sich also nicht um Zufall handeln, denn sonst hätten sie auch zufällig zerbrechen müssen.

    Ich plane diese Daten in einem beer-reviewed Journal zu publizieren (Acta Augustinica oder Transactions of the Radebeulian Society) und damit die Lorbeeren der Erstveröffentlichung zu ernten. Meine in Aussicht genommenen Reviewer müssen nur noch ihren Rausch ausschlafen.

    Freundliche Grüße

  51. #52 G.W.
    30. April 2012

    Beim Signifikanzlevel sind leider Zeichen verloren gegangen. Es ist wichtig: Signifikanzlevel d kleiner 0,05 m, und trotzdem eindeutig und unreproduzierbar Glas kaputt.

  52. #53 G.W.
    30. April 2012

    Leider sind wieder Zeichen verloren gegangen. Hieran sieht man, wie wichtig es ist, immer verschränkt zu sein. Der vorletzte Absatz zu 20:13 muss lauten:

    Gleichwohl erhielt ich ein wichtiges ballistisch signifikantes Ergebnis (Signifikanzlevel d kleiner 0,05 m). Eines der Gläser fiel um und zerbrach trotz winziger Fallhöhe. Als ich probeweise die anderen Gläser auch umwarf, blieben sie heil. Es kann sich also nicht um Zufall handeln, denn sonst hätten sie auch zufällig zerbrechen müssen.

  53. #54 Dr. Webbaer
    30. April 2012

    ‘Das Ganze wird noch irritierender, wenn man Walachs Ausführungen zu Ockhams Rasiermesser hier in diesem Text zur schwachen Quantentheorie liest.’ (Kuhn)

    -> http://www.anomalistik.de/Walach_WQT.pdf (Kapitel 2, Seite 7)

    Sehr lustig, danke für den Hinweis!

    MFG
    Dr. Webbaer

  54. #56 Joseph Kuhn
    1. Mai 2012

    Ich habe mir einmal das neue Buch “Weg mit den Pillen” von Harald Walach angesehen. Was esoterische Inhalte angeht, ist das Buch recht zurückhaltend. An mehreren Stellen schließt Walach die Möglichkeit physikalisch nicht erklärbarer Wirkungen zwar nicht aus, aber er wirbt auch nicht explizit für solche Ansätze. Im Wesentlichen ist der Titel des Buches Programm, d.h. es geht Walach darum, gegen ein mechanistisches Medizinverständnis und vor allem gegen die Pharmaindustrie anzuschreiben. Dabei macht er an manchen Stellen auf einige bekannte und durchaus diskussionswürdige Missstände aufmerksam, einschließlich des gesundheitspolitischen Einflusses der Pharmaindustrie. An manchen Stellen kippt seine Argumentation dabei allerdings ins Verschwörungstheoretische, z.B. wenn er behauptet: “Alle, die im Moment in unserem Gesundheitssystem Geld verdienen und von ihm profitieren, haben ein vitales Interesse daran, dass sich solche Einsichten eben genau nicht weiterverbreiten.” (Seite 190). Das ist mir neu. Die Medizinkritik hat schließlich nicht Harald Walach erfunden. Unfreiwillig komisch werden solche Thesen, wenn sie innerhalb eines Absatzes selbstwidersprüchlich werden. Auf Seite 46 schreibt er: “An einer Lebensstiländerung verdient nämlich niemand Geld. Der Arzt nicht (…). Die Pharmaindustrie nicht (…). Der Operateur und das Krankenhaus nicht (…). Die Einzigen, die dabei verdient hätten, wären ein paar Bioläden und -bauern (…), die Buchläden und der Verlag, die das Büchlein mit den passenden Ratschlägen vertreiben, und vielleicht ein Seminarleiter (…). Wer auch verdient hätte, wäre Helmuts Arbeitgeber bzw. Krankenkasse”. Helmut ist sein Fallbeispiel für eine Herzerkrankung. Innerhalb von 8 Zeilen widerlegt er seine eigene Behauptung. Warum Bioläden von einer Lebensstiländerung profitieren sollen, bleibt dabei sein Geheimnis. Auch Biowurst macht dick, wenn man zuviel davon isst. Aber vielleicht braucht er diese Idylle auch nur, damit die Profiteure “Arbeitgeber” und “Krankenkasse” nicht so wuchtig wirken. Das wären ja echte Gegengewichte gegen die Pharmaindustrie und damit ist die Frage offen, was den von Walach gewünschten Wandel wirklich blockiert.

    Manches, z.B. sein Lob der richtigen Ernährungsweise, ist mit Vorsicht zu genießen. Angesichts der permanten Revision von Ernährungsempfehlungen dürfte bei weitem nicht so klar sein, was richtige Ernährung ist und welche Effekte davon zu erwarten sind. Völlig unhaltbar ist seine Behauptung, dass Übergewicht 98 % (!) zum Risiko beitrage, an Prostatakrebs zu erkranken (S. 134). Aber vielleicht ist das auch nur ein Druckfehler.

    Ganz passabel sind seine Ausführungen zum Placeboeffekt und dessen mutmaßlicher Wirkungsweise. Insgesamt ist das Buch also kein “Aufreger”, eher ein Konglomerat an mehr oder weniger bekannten Kritikpunkten an der Medizin, ganz vernünftigen Überlegungen zur Selbstheilungsfähigkeit des Menschen, einem zu individualistischen Verständnis vom Entstehen von Krankheiten (es kommt praktisch nur das Verhalten vor) und deutlich überzogenen Schlussfolgerungen, was aus all dem für eine Reform des Gesundheitswesens abzuleiten ist.

    Da plädiert er dann für “Gesundheiterhaltungszentren” als Kern eines neuen Gesundheitswesens. Die würden aus Pauschalbudgets “allenfalls nötige medizinische Maßnahmen” bezahlen. “Welche, das stünde völlig in der Entscheidung des jeweiligen Zentrums. Das Ziel und die Aufgabe solcher Zentren wäre es, eine definierte Anzahl von Bürgern durchs Leben zu begleiten und ihnen dabei zu helfen, gesund zu bleiben. Wie, das sollte auch diesen Zentren überlassen bleiben. Möglicherweise erhalten sie Unterstützung in der Form von Systemberatung durch die Gesundheitskassen, aber keine regulierende und entmündigende Aufsicht”. (Seite 229). Nach all seinen vorherigen Darlegungen über die ja in der Tat nicht zu bestreitenden Fehlsteuerungen im Gesundheitswesen mutet diese Vision geradezu kindlich naiv an. Warum sollen plötzlich die Beteiligten an einem solchen System keine Partialinteressen mehr verfolgen, nicht mehr ihre Erträge auch auf Kosten der Gesundheit der Bürger maximieren, nicht mehr missliebige Studien unterdrücken und anderes mehr? Und das alles ohne “regulierende und entmündigende Aufsicht”? Ein solches Gesundheitswesen wäre vielleicht ein Paradies für alternative Heilverfahren aller Art, aber etwas gemeingefährlich kommt einem das schon vor. Dann kämen nämlich auch Heiler mit Masterarbeiten über den Kozyrev-Spiegel ganz ungehemmt zum Zuge. Und das soll dann die bessere Alternative zum gegenwärtigen Gesundheitswesen sein?

  55. #57 rolak
    1. Mai 2012

    Schönen Dank für die Lesearbeit, Joseph Kuhn.
    Kritik an der sogenannten Schulmedizin ist nichts Neues; Ernährungs-Umstellung schön und gut – doch es klingt zu sehr nach einem der ungezählten ‘mit x gegen jedwege Krankheit’-Konzepten; Placebo – nun ja, bei der WDR-Diskussion Anfang des Jahres tönte er noch von ‘Homöopathie mehr als Placebo’ und von einem soeben von ihm selbst veröffentlichten signifikanten Nachweis. Erstaunlich eigentlich, daß von dieser weltbewegenden Entdeckung bisher nichts zu hören gewesen war…

    Bei “Gesundheiterhaltungszentren” mußte ich zuallererst an 1984/Orwell denken, speziell ‘durchs Leben zu begleiten’ klingt ein wenig nach Gedankenpolizei und Verhaltens-Vorschrift. Denn worin sollte sich sonst dieses ach so revolutionäre Konzept von den von jeder Krankenkasse (zur langfristigen Kostendämpfung) angebotenen Vorsorge- und Fitness-Kursen im Verbund mit hausärztlicher Betreung unterscheiden?
    Oder ist H.W. etwa der absurden Meinung, ein dichtes Netz dieser GEZ (hehe^^) würde Krankenhäuser etc unnötig machen?

    Nein, zusätzlich zu Deinen mehr als berechtigten Zweifeln an der urplötzlichen Bekehrung der Menschheit zum Altruismus müffelt das alles für mich nach einem (mehr oder weniger) geschickten PR-Feldzug á la “Ich habe hier etwas gut klingendes Alternatives im Angebot. Und wo wir gerade dabei sind, hätte ich auch noch <voodoo#1>..<voodoo#0815>”.

  56. #58 G.W.
    1. Mai 2012

    @Joseph Kuhn

    Danke für diese Erläuterungen. Ich habe Herrn Walach auch als mehrdeutig erlebt. Zum einen schon um Wissenschaft im konventionellen Sinne, Objektivierbarkeit und Prüfbarkeit bemüht. Zum anderen dann wieder als einen geschickten Begriffsausschweifer und Assoziationsvernebler mit der üblichen psychophilosophischen Hintergrundrhetorik.

    Die sogenannte verallgemeinerte Quantenmechanik, die auch zur Interpretation der Masterarbeit angerufen wird, ist ein solcher Schmarren im Gefolge von Capra&Co. Von der „Komplementarität zwischen Wellen und Teilchen“ (die nicht das Kernproblem der QT berührt, das liegt viel tiefer) geht es zu der zwischen irgendwas1 und irgendwas2 wie Diagnose&Therapie, ohne Grenze zu Ying&Yang, Ping&Pong, Hans&Franz. Natürlich, wie könnte es anders sein, muss zentral die „Verschränkung“ herhalten, auch wenn es inzwischen eine umfangreiche Forschung dazu gibt, warum gerade in unserer Alltagswelt Superpositionen von Quantenzuständen regulär nicht zu beobachten sind, sondern durch Interaktion zwischen System und Umwelt (Dekohärenz) in enorm kurzer Zeit in „klassische“ Systeme und entsprechende Observable überführt werden. Es gibt keine Daten, die direkt Kohärenz in biologischen Systemen über eine so lange Zeit belegen, dass man in die Größenordnung der Zeitkonstanten typischer biochemischer Reaktionen kommt. Das erscheint aber als Voraussetzung dafür, dass beobachtbare Konsequenzen auftreten; alle konkreten Kandidaten sind nur theoretische Modelle und extrem limitiert. Makroskopische, beobachtbare Kohärenz in Modellsysteme muss vielmehr mühsam experimentell hergestellt und gegen das allgegenwärtige Rauschen aufrechterhalten werden.

    Somit reduziert sich die verallgemeinerte Theorie darauf, dass irgendwie alles mit allem zusammenhänge, nur jetzt eingekleidet in populärphysikalisches Vokabular, das den Laien beeindrucken kann. Nichts davon ist so formuliert, dass es zu quantitativ oder auch nur qualitativ eindeutigen und prüfbaren Konsequenzen führt. Ein reines post hoc-Interpretationsschema. Damit lässt sich dann Beliebiges erklären, und ohne weiteres auch Geistheilung.

    Was Sie im letzten Absatz beschreiben, finde ich ebenfalls erschreckend. Es ist allerdings eine bekannte Strategie, durch Regionalisierung (und Privatisierung) allgemein verbindliche (Mindest-)Standards außer Kraft zu setzen und so sich selbst die Bahn zu eröffnen. Das entspricht der wedge strategy des Intelligent Design, dem Vorgehen evangelikaler Privatschulen usw. Diese Beispiele zeigen auch, dass Dogmatik, Vorurteil und handfestes Interesse auf der einen Seite und ein Plädoyer für Offenheit, Toleranz und Pluralität auf der anderen Seite verbal verträglich sein können, solange das eine nur als Türöffner für das andere fungiert. Später sieht es dann anders aus. Hüten wir uns vor solchen Entscheidern über „allenfalls nötige medizinische Maßnahmen“.

    Dass eine übertriebene Darstellung von Risikofaktoren zur nach wie vor kurrenten Phrase von der „Eigenverantwortung“ (statt „Mitverantwortung“) passt, sei nur nebenbei erwähnt. Es handelt sich bei Risikofaktoren ja in der Regel um nur statistisch nachweisbare Faktoren, die individuell wenig Vorhersagewert haben. Der individuelle Verlauf wird nicht nur von den Risikofaktoren und Genen, sondern schlicht und einfach in hohem Maße vom Zufall bestimmt; schon innerhalb einer Zellkultur sieht man bei Einzelzellanalyse die Heterogenität der Antworten. Insofern erinnern mich die Advokaten einer strikt gesunden Lebensweise, Ernährung usw. an religiöse Eiferer ums Seelenheil. Und in der Tat kam das alles ja um 1800 auf, als die Religionen begannen, im öffentlichen Leben der „Gebildeten“ an Einfluss zu verlieren.

  57. #59 Joseph Kuhn
    1. Mai 2012

    Das System hat mal wieder ein paar Kommentare festgehalten. Sorry. Ich hoffe, jetzt sind alle da.

  58. #60 rolak
    1. Mai 2012

    Vielen Dank für die Kommentarpflege, Joseph Kuhn, doch ich hatte aus den Erfahrungen des letzten Mals heraus vorsichtshalber eine lokale Kopie gesichert ;-)

  59. #61 echt?
    2. Mai 2012

    Die Uni in Frankfurt/Oder hat sich längst von der Wissenschaft verabschiedet. Herr Pleuger und sein Senat wissen ganz genau, dass der Esoterikfisch stinkt. Aber der Rubel rollt und das ist wichtig.

    bedauert echt?

  60. #62 Dr. Webbaer
    2. Mai 2012

    Der Schreiber dieser Zeilen hat folgenden Eindruck gewonnen, der grob und skizzenhaft Walachs Ansatz wiedergeben soll:
    Die traditionelle oder besser vielleicht: Moderne Wissenschaftlichkeit basiert auf dem Erfassen oder Messen in der Welt vorkommender Ereignisse (richtig), d.h. es gibt etwas, das sich dem Erkenntnissubjekt nicht nur im Moment nicht erschließt und erschließen kann (richtig), sondern auch etwas, das nie gemessen und theoretisiert werden kann (richtig, zumindest im Sinne des Skeptizismus).

    Jetzt will er aber an Letztgenanntes doch irgendwie ran und öffnet so gewollt oder ungewollt die Tür zur Esoterik und zur Gaukelei. – Richtig erscheint dagegen die Ausschnittsartigkeit der anthropogenen Vorhaben anzunehmen, aber nicht auf Basis dieses Vorbehalts in irgendeiner Hinsicht auszubauen, bspw. im Sinne einer “Generalisierten Quantentheorie”. Weil das unzulässig wäre.

    MFG
    Dr. Webbaer (der sich hier nicht gegen wahlfreie Experimente gewendet hat)

  61. #63 G.W.
    2. Mai 2012

    @ Dr. Webbaer

    Gerade wegen der systematisierten, kritisch prüfenden Vorgehensweise kann die Wissenschaft nur Teilaspekte unserer Erfahrungswelt beschreiben, und die auch nur vorläufig bzw. revidierbar. Die Kehrseite einer mehr oder weniger hohen theoretischen Verlässlichkeit und praktischen Brauchbarkeit von Aussagen ist deren Begrenztheit. Wer alles erklären kann, erklärt nichts. Daher ist es eine notwendige Bedingung von Erklärung, nicht alles erklären zu können.

    Die damit verbundene Unsicherheit kommt aber dem Bedürfnis vieler Menschen nach 1. Gewissheit und 2. persönlicher Befriedigung bzw. Einbindung nicht entgegen. Da springen dann die Theorien ein, welche möglichst einfach zugleich die physische Welt erklären und Sinn&Trost liefern. Die Religionen können das nicht mehr recht leisten, bzw. nur noch um den Preis einer offenkundigen Schizophrenie, seit sie ihren Anspruch auf Erklärung der physischen Welt, von Kometen bis Epidemien, reduzieren mussten. Daher die zunehmende Selbstbeschränkung auf Sinngebung. Die Weltbeschreibungen sind halt recht alt. Alt heißt hier aber hoffnungslos veraltet, da hilft keine Exegese, die nicht Wortklamauk ist. Dass in diesen Kreisen oft Alter als Beleg für Richtigkeit gilt, ist einfach nur kurios.

    Nicht ohne Grund hält man sich inzwischen, was die physische Welt anbelangt, zumeist nur noch an die geheimen Kräfte der Evolution (Intelligent Design etc.) oder der Kosmologie (Feinabstimmung etc.). Die scheinen den Vorteil zu haben, immer eine Nische bieten zu können, da die historischen Bedingungen niemals in jedem Detail eruierbar sein werden. Auch mit den avanciertesten Modellen wird man diese Vorgänge nicht in jedem Detail sozusagen hieb- und stichfest belegen können, es geht (wie allerdings auch sonst in der Wissenschaft) nur um Plausibilitätsgrade (evidence).

    Andererseits liefert das natürlich nur etwas für Leute mit „intellektuellem“ Bedürfnis oder Fanatiker, nichts für den Alltag. Genau hier ist der Platz für die ganz&gar verallgemeinerte Quantenrede, die wellende&schwellende Zeit, den hellenden&dellenden Raum etc. Die erklären, warum Hans&Franz miteinander können, auch Ping&Pong, aber nicht, oder vielleicht doch, Hinz&Kunz und Ding&Dong. Und da die moderne theoretische Physik ja tatsächlich so etwas wie Strings, Quantenschaum, topologische Spinnetzwerke usw. in avancierten spekulativen Modellen diskutiert, wirkt das dann so, als habe man seine Hand am Puls der Forschung und übersetze nur in die Lebenspraxis, worauf die „Schulwissenschaft“ auch so langsam kommt.

    Das hat m.E. durchaus Zukunft, und zwar gerade wegen der formalen Anhebung des Bildungsniveaus. Die hob die geistigen Ansprüche, nicht jedoch den geistigen Anspruch. Der bewegt sich nach wie vor auf dem Niveau von Luftgeistern, Eingeweideschauen und Schadenszauber. Die wirken aber jetzt etwas krude, da muss Meditationsmediation beim Cappuccino mit Personalitätsquantenschaum und zeitwellengeriebener Heilschokolade her (das geht bei unter 1 Promille der Lichtgeschwindigkeit, solange man den Unterschied zwischen Stunden und Sekunden als in esoterischer Näherung vernachlässigbar betrachtet, es handelt sich mathematisch um eine sogenannte Viadrina-Entwicklung in Analogie zur klassischen Taylor-Entwicklung). Durchaus auch in einem Aluzylinder mit kosmokosmischer Seinsabstimmung auf 2 Plancklängen im Quadrat genau.

  62. #64 Dr. Webbaer
    2. Mai 2012

    @G.W.
    Schon klar, findet denn die o.g. Betrachtung Ihre Zustimmung, lag Dr. Webbaer halbwegs richtig?

    MFG
    Dr. Webbaer

  63. #65 G.W.
    2. Mai 2012

    @ Dr. Webbaer

    Der erste Absatz wirkt auf mich unklar, obgleich ich glaube zu verstehen, was Sie meinen. Der zweite Absatz beschreibt in etwa den Spagat zwischen inkompatiblen Welten, den Herr Walach aus welchen Gründen auch immer leisten möchte. Daher dann auch der prinzipielle Weg der Masterarbeit (und anderer Arbeiten), quasi-wissenschaftlich zu zeigen, dass die konventionell wissenschaftliche Analyse eigentlich das betrachtete Phänomen zerstöre, und dies als Hinweis darauf zu nehmen, dass das Phänomen real sei. So hat man den Freiraum der Nichtwissenschaft wissenschaftlich ausgegrenzt und gibt nun diese Begrenzung als Beleg eines vorgeblichen Gehalts des Freiraums aus. Es ist ungefähr so, als ob ich behauptete, nicht ich selbst trüge meine Kleider, sondern der Raum um mich herum, und deshalb müsse sich in jeder ähnlichen Zusammenstellung von Kleidungsstücken auch eine Person befinden, nicht etwa vielleicht nur eine beliebige Schaufensterpuppe.

  64. #66 Joseph Kuhn
    2. Mai 2012

    “etwas, das nie gemessen und theoretisiert werden kann”

    Ich bin mir nicht ganz sicher, ob ich verstehe, was Sie meinen. Dass es etwas gibt, “das nie gemessen und theoretisiert werden kann” ist zwar anzunehmen, die Frage ist, was das vernünftigerweise sein kann, was daraus folgt und ob es Walach darum geht. Wie sagt Wittgenstein so schön in Satz 6.52 des Tractatus: “Wir fühlen, daß selbst, wenn alle möglichen wissenschaftlichen Fragen beantwortet sind, unsere Lebensprobleme noch gar nicht berührt sind. Freilich bleibt dann eben keine Frage mehr; und eben dies ist die Antwort”. Und der Schlusssatz des Buches lautet: “Wovon man nicht sprechen kann, darüber muss man schweigen”. Ich glaube aber, darum geht es Walach nicht. Ihm geht es darum, für erfahrbare, aussprechbare und beschreibbare Phänomene eine Theoretisierung zu finden, die über unseren physikalischen Rahmen hinausgeht. Das ist in dieser Allgemeinheit auch noch keine Esoterik, unser physikalischer Rahmen wird sich schließlich ganz sicher weiterentwickeln, tausende von Wissenschaftlern rund um die Welt arbeiten daran. Esoterik wird erst daraus, wenn unnötigerweise eine Art “Nebenphysik” entsteht, die Ockham vielleicht noch in der Einleitung zitiert, dann aber ganz ungeniert trotzdem neue Wesenheiten, Energieformen, Elementarteilchen etc. erschafft, um irgendetwas zu erklären, von dem noch nicht einmal sicher ist, dass es sich nicht bloß um Einbildung handelt. Dann werden scheinbar bessere “Intuitionen” im Alukessel eben mit einer neuen Physik erklärt, wie bei der hier diskutierten Masterarbeit. Esoterik ist eine Art Denkfaulheit, weil sie sich nicht bemüht, Phänomene vernünftig zu erklären, sondern einfach das Unerklärte nocheinmal verdinglichend dazuphantasiert. Erklärt ist damit aber nichts, nur erfunden.

  65. #67 Joseph Kuhn
    2. Mai 2012

    Auf der Internetseite des INTRAG finden sich jetzt Stellungnahmen zur Masterarbeit, einmal als Mitteilung auf der Startseite und einmal als offener Brief der Professoren Walach und Schmidt, die die Masterarbeit betreut haben.

    In der Mitteilung auf der Startseite kann man lesen:

    “Wer uns hier unwissenschaftliches Vorgehen vorwirft, versteht nichts von Wissenschaft und hat die betreffende Arbeit von Herrn Conrad nicht gelesen: Die Tatsache, dass die Arbeit Kozyrev widerlegt ist von den aufbrausenden Kritikern offensichtlich übersehen worden.”

    Und etwas später:

    “(…) Somit widerlegt das Experiment die untersuchte Theorie, zeigt aber auch, dass unter speziellen Bedingungen eine von der Zufallserwartung abweichende Trefferquote vorkommen kann, was als erster Hinweis für “Hellsehen” gewertet werden kann – nicht jedoch als hinreichender Beweis.”

    In der Masterarbeit steht auf Seite 29:

    “Die Wirksamkeit der Spiegel halte ich für erwiesen wegen:
    - der Ergebnisse der Vorexperimente
    - der Ergebnisse im Testarm 2 “offen” für den Spiegel”

    Hier steht also nicht “widerlegt” sondern “erwiesen”. Der Autor der Masterarbeit teilt demnach, so lese ich diesen Passus, nicht die Interpretation seiner Betreuer. Die weiterführende Interpretation der beiden Professoren, das Experiment widerlege die Kozyrevtheorie, liefere aber statt dessen einen Hinweis auf “Hellsehen”, macht die Sache aus meiner Sicht auch nicht wirklich besser.

  66. #68 Joseph Kuhn
    3. Mai 2012

    Kleiner Nachtrag: Sehr aufschlussreich im offenen Brief der Professoren Walach und Schmidt ist auch dieser Satz:

    “Mittels unbewiesener Meinungen bestimmte Themen als unwissenschaftlich zu bezeichnen – und deswegen nicht empirisch zu untersuchen – ist eine Verbreitung von Vorurteilen und nicht von wissenschaftlich fundierter Erkenntnis.”

    Den Stand der Wissenschaft in der Physik als “unbewiesene Meinungen” und eine darauf aufbauende Kritik als “Verbreitung von Vorurteilen” zu bezeichnen – das nenne ich Chuzpe. Der Mut der Verzweiflung wird es angesichts der anhaltenden Rückendeckung für das Institut ja wohl noch nicht sein.

  67. #69 Dr. Webbaer
    3. Mai 2012

    Janz einfach: Die Arbeit von Kozyrev mag widerlegt sein, nicht aber nie neu gewonnenen Ergebnisse der Masterarbeit.

    MFG
    Dr. Webbaer (der noch dafür dankt, man ist also bei der Viadrina anscheinend, auch das Multikulturelle berücksichtigend, ein wenig locker geworden – Spontan geäußerter Verdacht: Da liegen noch zig Leichen im Keller.)

  68. #70 Ponder
    3. Mai 2012

    @ Joseph Kuhn:

    Die Reaktion der Herren Walach und Schmidt erinnert mich an den “alten Wiener Taxler-Schmäh: rechts blinken und links abbiegen!” ;-)

    Und ich sehe schon weitere Verwicklungen am Horizont dreuen.

    Immerhin wird der Kozyrev-Spiegel durch die Firma Fostac in Kursen mit dem Energy Mediziner Manfred Doepp vermarktet.

    http://www.esowatch.com/ge/index.php?title=Manfred_Doepp

    Letzterer hat die Masterarbeit von Conrad bereits in seine Kursunterlagen aufgenommen:

    http://www.fostac.ch/de/kurse/beschreibung/erfahrungstag-kozyrev-spiegel.html?changetogermanysite=false

    Herr Walach hat eine offizielle Zusammenarbeit seines Studiengangs mit der DGEIM

    http://www.esowatch.com/ge/index.php?title=DGEIM

    ja stets bestritten (und mittels Umschichtungen der offiziellen IntraG- Verlautbarungen in 2010 kaschiert) – es bleibt also abzuwarten, wie Manfred Doepp bzw die DGEIM auf die Stellungnahme von Walach und Schmidt hinsichtlich der “Widerlegung” der Kozyrev-Theorie reagieren werden…

  69. #71 G.W.
    3. Mai 2012

    @ Joseph Kuhn

    Eines der Probleme, auf das Sie ja schon hingewiesen hatten, besteht darin, dass eine Hypothesenbildung sinnvoll im Lichte des Bekannten sein muss. Wenn ich die Hypothese bilde, dass immer dann, wenn in Deutschland mindestens 10 Leute gleichzeitig (innerhalb von plusminus 1 Sekunde) niesen, ein Luftschauer aus kosmischer Strahlung im Karlsruher Detektor KASCADE-Grande aufgrund quantenmechanischer Verschränkung auftritt, ist das eine testbare Hypothese (mit zu entwickelnden pflichtzutragenden Niesdetektoren mit automatischer Datenübertragung). Trotzdem wird man dafür schwerlich Forschungsfördermittel erhalten, da die Hypothese nicht im Entferntesten in concreto über bekannte Mechanismen oder vorläufige Beobachtungen begründbar ist.

    Dass die Esoterik regelhaft beansprucht, auf der Basis einer sehr liberalen Auslegung methodologischer und theoretischer Standards grundsätzlich Neues zu finden, ist klar (dass sich das Neue dann oft als Variante eines seit alters her Kolportierten herausstellt, gibt dem eine kuriose Note). Dem korrespondiert das Verfahren, gleichzeitig den Gültigkeits-Nimbus von Wissenschaft zu beanspruchen und deren Standards zu unterlaufen. Sie finden das Gleiche bei Anhängern des Intelligent Design usw. Insofern haben Worte wie „Verbreitung von Vorurteilen und nicht von wissenschaftlich fundierter Erkenntnis“ schon etwas Delikates.

    Ganz abgesehen davon sind auch die Daten der Masterarbeit m.E. kein Beleg für irgendetwas. Die Analyse ist naiv und nicht nachvollziehbar. Prozentsätze nahe Null testet man nicht mittels Normalverteilung (z-Score), da kommt die Asymmetrie bereits zum Tragen. Zur Beurteilung von Übereinstimmung gibt es Korrelationsmaße. Die erhöhte Fehlerwahrscheinlichkeit erster Art durch die große Zahl von Tests ist nicht berücksichtigt. Vor allem aber sähe man gerne die Verteilung der Zahlen bzw. deren Korrelationen, wenigstens als Graphiken in einem Anhang, wenn schon nicht als numerische Tabellen. Bloße „Trefferquoten“ reichen m.E. bei relativ kleinen Datenmengen nicht, dazu schlagen Ausreißer in den Daten zu schnell durch. Ich verlange bei Arbeiten über unrevolutionäre Themen Derartiges regelhaft, damit jeder Leser die Sache nachvollziehen kann. Schade, dass Herr Walach hier nicht einfach sagt „das war wohl nichts, wir werden es künftig besser machen“, sondern sich dazu versteigt, ins Prinzipielle auszuweichen. Das Banner einer Erkenntnis, die verdient so genannt zu werden, dürfte man so schwerlich hochhalten.

  70. #72 Dr. Webbaer
    3. Mai 2012

    Trotzdem wird man dafür schwerlich Forschungsfördermittel erhalten, da die Hypothese nicht im Entferntesten in concreto über bekannte Mechanismen oder vorläufige Beobachtungen begründbar ist.

    Hier könnte sich etwas geändert haben – http://www.who.int/medicines/areas/traditional/congress/beijing_declaration/en/index.html -> http://www.europa-uni.de/de/forschung/institut/institut_intrag/institut/Hintergrund.html

    HTH
    Dr. Webbaer

  71. #73 Andreas
    3. Mai 2012

    ich will noch einmal auf den Ausgangspunkt zurückkommen. Zwei Aspekte machen mir Sorgen: ein Wissenschaftsverständnis der Beliebigkeit. Oder schlimmer noch: diese Masterarbeit und die Vorgänge der Annahme und jetzt auch noch Verteidigung durch den Betreuer entsprechen nicht seriösen Standards. Zweitens und das besogt mich noch mehr: In Frankfurt / Oder werden Zertifikate verteilt, mit denen in der medizinischen Versorgung geworben wird. Immerhin haben deutsche Hochschulen einen durchweg guten Ruf. Patienten lassen sich so täuschen. Humbug macht aber nicht gesund.

  72. #74 G.W.
    3. Mai 2012

    @Dr. Webbaer

    Wir werden sehen, was gefördert wird.

    Solange die Standards wissenschaftlichen Arbeitens eingehalten werden, kann man ja durchaus Praktiken „traditioneller Medizin“ als begründeten Ausgangspunkt einer Prüfung nehmen. Der Trick liegt woanders, in der Umdefinition von „Wissenschaft“, die darauf abzielt, das Resultat der Prüfung vorwegzunehmen, indem man die Maßstäbe der Gültigkeit ändert. Es geht dann nur noch um „interne Konsistenz“ (die auch jedes Wahnsystem haben kann), nicht mehr um externe, empirische Fundierung (typisch für Wissenschaft im eigentlichen Sinne). Sie sehen das auf der Internet-Seite des Instituts, die Sie noch einmal angegeben haben, wunderschön in folgendem Übergang illustriert.

    Heißt es im vorletzten Absatz: „In erkenntnistheoretischer Hinsicht beabsichtigen transkulturelle Wissenschaften die Begegnung verschiedener kultureller Konzepte der Erkenntnisgewinnung und streben die Sichtung des Erfahrungswissens aller Kulturen an“, so ist das ja akzeptabel. Allerdings ist der Begriff des „Wissens“ ja schon an sich problematisch und hier voraussehend über die diffuse Vokabel „Erkenntnisgewinnung“ auf „Erfahrungswissen“ hin moduliert und somit schon in eine bestimmte Richtung vorgebahnt.

    Nach einigem Herumeiern auf dem Begriff der „Offenheit“ wird daraus nun im letzten Absatz Folgendes: „Einerseits stehen transkulturelle Wissenschaften für einen konsequenten Pluralismus und verfolgen das Ziel eines gleichberechtigten wissenschaftlichen Diskurses zwischen den unterschiedlichen Wissenschaftskulturen“. Flugs haben wir nicht mehr unterschiedliche Wissenskulturen (ein kulturwissenschaftlich, ethnologisch usw. durchaus sinnvoller Begriff), sondern unterschiedliche Wissenschaftskulturen (nonsense, es gibt nur die eine, westliche Wissenschaftskultur, keine chinesisch traditionelle usw.).

    Ich bin aber immer noch zuversichtlich, dass derartige Äquilibrations-Taschenspielertricks bei Förderern nicht verfangen, außer bei primär politisch dominierten, bei denen Rationalität sowieso keine Rolle spielt.

  73. #75 Joseph Kuhn
    3. Mai 2012

    @ G.W.:

    “Eines der Probleme, auf das Sie ja schon hingewiesen hatten, besteht darin, dass eine Hypothesenbildung sinnvoll im Lichte des Bekannten sein muss.”

    Im offenen Brief der beiden Professoren heißt es dazu: “Allerdings ist es Kennzeichen guter Wissenschaft, dass sie alles, auch vermeintlich unwahrscheinliche Ideen, einer konzeptuellen und empirischen Prüfung unterzieht”.

    Das klingt so freundlich unvoreingenommen. Teil der “konzeptuellen Prüfung” wäre genau die Frage danach, was eine Idee im Lichte des Bekannten bedeutet. Man wird dann, wie Sie sagen, eben nicht jede Idee auch noch einer empirischen Prüfung unterziehen. Es sei denn, man stellt sich dumm und lässt den Erkenntnisprozess immer ganz neu beginnen, weil alle bisherigen Erkenntnisse nur “unbewiesene Meinungen” sind, wie es etwas später im Professorenbrief heißt. Dann ist es wie einer Zeitschleife: Und täglich grüßt das Murmeltier.

    Vielleicht sollten die beiden Professoren ihren erkenntnistheoretischen Leitsatz einmal auf sich selbst anwenden und anhand des Textes der Masterarbeit die aus ihrer Sicht “unwahrscheinliche Idee” überprüfen, dass Literaturrecherche, theoretisches Konzept, Versuchsaufbau und Dateninterpretation vielleicht doch nicht so “herausragend” sind, wie sie meinen, oder vorgeben zu meinen.

    Insgesamt erinnert der Vorgang immer mehr an die Causa Guttenberg: Man macht einen Fehler, der Fehler wird erst einmal bestritten, die Kritiker werden kritisiert – und je nachdem, wie stark der Druck wird, räumt man dann den Fehler ein oder man ist noch einmal davongekommen.

  74. #76 G.W.
    3. Mai 2012

    @ Joseph Kuhn

    Es ist natürlich immer eine Gratwanderung, und die Originalität einer neuen Idee bedingt auch das Risiko des Scheiterns. Die Auslassungen von Herrn Walach allerdings spielen wieder einmal nur mit der vielberufenen Offenheit für Alles, die sich bei Laien immer gut macht.

    Ich meine, eine einfache Selbstkontrollmaßnahme (die ich verwende) ist diejenige, sich zu fragen, ob die Daten auch im Falle eines negativen Ergebnisses noch publizierbar sind (eher nicht gut, aber immerhin). Bei positiven Ergebnissen ist es ja (wegen der falsch-positiven Ergebnisse auch leider) keine Frage. Wenn man sich aber im Vorfeld sagen muss, dass niemand anders einem abnimmt, wenigstens eine originelle, interessante Idee gehabt zu haben, die sich aber leider nicht bestätigt hat – dann sollte man skeptisch werden. Man muss es dann noch nicht bleiben lassen, falls man es sich von seinen Ressourcen her erlauben kann. Es ist aber dann eher eine Privatsache, ein Hobby.

    Hinzu kommt, dass die vorgeblich neuen Ideen aus der Richtung von Herrn Walach ja gar nicht so neu sind, sondern in der Regel dem seit Mesmer&Co. reiterierten Kram entsprechen, ohne sich jemals substantiiert zu haben. Neu ist nur das einkleidende Vokabular. Früher war es der geheimnisvolle Magnetismus, heute halt die nichtlokale Quantenverschränkung. Und die uralten Weisheiten ziehen sowieso immer.

  75. #77 zwecke
    4. Mai 2012

    Aktueller Medienauftritt von Walach in BR-alpha – siehe Mediathek
    „Was wir noch nicht wissen: Wie wirkt Homöopathie?“
    (Beitrag wird im Moment noch bei Aufruf der Website BR-alpha direkt angezeigt, den Redakteuren scheint die Homöopathie also insbesondere an Herzen zu liegen)
    http://www.br.de/fernsehen/br-alpha/index.html

    Was lehrt BR Alpha dem Zuschauer?
    1. Homöopathie wirkt
    2. Homöopathie wirkt, nicht als reiner Placeboeffekt
    4. Das Homöopathie wirkt, ist wissenschaftlich bewiesen (Bsp. Wasserlinsen-Studie)
    3. Es gibt verschiedene Erklärungsansätze zum Wirkungszusammenhang –
    a) Einen erklärt selbstverständlich Walach (Minute 09.55)
    b) Der Erklärungsansatz (Wassergedächtnis) von Baumgartner (Minute 11:00) ist aber auch nicht schlecht [nur, auf die schnelle habe ich jetzt keine Publikation dazu gefunden]
    ——————————————-

    Was sagt eigentlich Zeilinger zu diesem innovativen Verschränkungs-Erklärungsansatz?:
    http://www.sueddeutsche.de/wissen/umstrittenes-heilverfahren-homoeopathie-missbrauchte-studien-1.1267699

    “Dass ein Bezug zwischen meiner Arbeit und der Homöopathie hergestellt wird, ist wissenschaftlich unbegründet”, sagte Zeilinger Süddeutsche.de. “Ich bedaure es sehr, dass mein Name damit in Verbindung gebracht wird.”

    Dafür, dass ein Wirkstoff Informationen in einer Lösung hinterlässt, in der er selbst nicht mehr enthalten ist, “gibt es keinerlei wissenschaftliche Beweise”, erklärt der Physiker. “Homöopathie ist in meinen Augen ein reiner Placeboeffekt.” Auch von der sogenannten Quantenmedizin hält er nichts. “Das ist ein schwammiger, spekulativer Begriff, nicht die Bezeichnung eines wissenschaftlichen Gebietes.”

    ————————————————————————————
    Zur (in keinem anderen Labor reproduzierten) Wasserlinsen-Studie fand ich Folgendes aufschlussreich:

    http://www.skeptiker-blog.ch/2011/06/zu-besuch-bei-homoopathen.html
    &
    http://www.informationen-zur-homoeopathie.de/?p=417
    Dr. Stephan Baumgärtner zitiert:
    „Ein immer wieder beobachtetes Phänomen ist etwa, dass Ergebnisse innerhalb des eigenen Labors einfacher zu reproduzieren sind als in anderen Labors.“

  76. #78 ZetaOri
    4. Mai 2012

    @zwecke· 04.05.12 · 00:04 Uhr

    [...] „Ein immer wieder beobachtetes Phänomen ist etwa, dass Ergebnisse innerhalb des eigenen Labors einfacher zu reproduzieren sind als in anderen Labors.“

    Das wäre dann aber ein deutliches Indiz gegen die “Nichtlokalitäts”-Hypothese. Zumindest scheint es da ein sehr lokales Labor-”Gedächtnis” zu geben.
    Wurden die jeweiligen Labors schon auf das Fehlen / Vorhandensein vom morphischen Feldern ausgependelt?
    ;o)

  77. #79 rolak
    4. Mai 2012

    morphischen Feldern ausgependelt?

    Warum? Pendeln ist völliger Quatsch.
    Die morphischen Felder spürt mensch doch.

  78. #80 Joseph Kuhn
    4. Mai 2012

    @ rolak: … zumindest im Kozyrev-Spiegel spürt mensch das ;-)

    Der Beirat des Walach-Instituts verändert sich übrigens gerade. Es gibt Abgänge und Neuzugänge. Der FAZ sagte Walach im Zusammenhang mit Global Scaling-Verfechtern in seinem Beirat, der Beirat sei ein „Fossil“. „Da muss kräftig ausgemistet werden.“ Allerdings scheiden offensichtlich auch Personen aus, die für unkonventionelle Wege in der Medizin durchaus offen sind, aber Walach dabei nicht auf seinen esoterischen Wegen folgen wollen. In einer Antwortmail an einen Beirat, der sich von der hier diskutierten Masterarbeit distanziert hat, schreibt Herr Walach: “Ich möchte auch nur mit Menschen in unserem Beirat zusammenarbeiten, die eine Wissenschaftskonzeption vertreten, die dem momentan akzeptierten und etwas fortschrittlicheren Denken nahestehen und habe daher keine Probleme, wenn Sie die Sache anders sehen und auch aus unserem Beirat ausscheiden wollen. Das werde ich gerne veranlassen.” Die unfreiwillige Komik mit der “momentan akzeptierten Wissenschaftskonzeption” einmal dahingestellt, wohin verändert sich also der Beirat? Scheiden die Global Scaling-Vertreter aus oder die Kritiker solcher Dinge? Und wem von den Beiräten ist wohl bewusst, welche seltsamen Masterarbeiten an dem Institut geschrieben werden, das sie mit ihrem Namen zieren? Wie gesagt, unkonventionelle Ansätze in der Medizin zu erforschen, ist sicher sinnvoll, Kritik an der zu starken Ausrichtung der Medizin auf ein biomedizinisches Paradigma ist auch erlaubt und in manchen Bereichen notwendig, aber wissenschaftlich sollte es dabei schon noch zugehen.

  79. #81 Joseph Kuhn
    4. Mai 2012

    @ Zwecke:

    Danke für den Hinweis auf den BR-Beitrag. Hier der Direktlink zum Beitrag:
    http://www.br.de/fernsehen/br-alpha/sendungen/was-wir-noch-nicht-wissen/homoeopathie138.html

    Der Beitrag ist offensichtlich von keinem Zweifel an die Wirksamkeit der Homöopathie angekränkelt: “Dass sie ein wirksames Heilmittel ist, gilt als unbestritten”, heißt es an einer Stelle des Beitrags. Das zumindest kann man ja nicht sagen, egal was man von den berichteten Experimenten hält. Die Experimente müssten auf jeden Fall reproduziert werden. Da sollten die Erfahrungen mit Jacques Benveniste vorsichtig stimmen. Trotzdem würde ich das gerne getrennt von der Diskussion um die Kozyrev-Masterabeit halten, und dass der Bayerische Rundfunk so unkritisch über die Homoöpathie berichtet, wäre ohnehin einen eigenen Blogbeitrag wert.

  80. #82 echt
    4. Mai 2012

    die beiraete sind doch teils noch schlimmer als die studierenden, z.b. der astrologe

    gruesst echt

  81. #83 Statistiker
    6. Mai 2012

    Die p-Werte in der Arbeit sind allesamt falsch berechnet!

    Es wurden einerseits anstatt eines Binomialtestes implizit einfach ein Gauß-Test verwendet. Dies geschieht nur durch Verweis auf eine Internetseite, in der man p-Werte aus z-Werten für Standardnormalveteilungen berechnen kann ohne weitere Begründung (siehe S.19 unten).
    Zweitens wurde anstatt eines einseitigen Tests ein zweiseitiger Test verwendet. Das sieht man nur an der Formulierung
    “Das entspricht hier einem z-Wert größer 1,96 oder kleiner -1,96″,
    was so überhaupt keinen Sinn macht.
    Soviel dazu, dass hier “wissenschaftlich methodisch korrekt” gearbeitet wurde….
    Da ist nicht nur die Methode fragwürdig, sondern auch die Transparanz der Zahlen…

  82. #84 G.W.
    6. Mai 2012

    @statistiker

    Stimme Ihnen zu (siehe meinen Kommentar vom 03.05., 16:13). Man muss bei den relativ geringen Fallzahlen Tests für Proportionen verwenden bzw. Tests für Übereinstimmungen (Korrelationen); am einfachsten wäre z.B. Fisher’s exact test in entsprechenden Vierfeldertafeln gewesen. Man sollte auch berücksichtigen, dass viele Tests parallel erfolgen, und den Fehler erster Art im Einzeltest nach unten korrigieren (m.E. mindestens auf p=0,01); dann stellt sich natürlich die Frage nach der Teststärke (Power), für die auch keine Vorabschätzung präsentiert wird.

    Allerdings kann man sehr wohl zweiseitig testen, wenn man als Ausgangshypothese auch die Möglichkeit eines inversen Effektes zulässt. Ferner wäre es ja mit einem einseitigen Test (z =1,64) „noch signifikanter“ geworden.

    Der Hauptpunkt ist aber, dass für eine Arbeit, die diese Implikationen beansprucht, alle Originaldaten vorgelegt werden müssten. Das alles hat wie der erlebnishafte Schreibstil und die assoziative, wirre Diskussion etwas Hobbymäßiges.

  83. #85 G.W.
    6. Mai 2012

    Nachtrag zu 15:32: Je nachdem, wie die Daten dargestellt werden, wäre natürlich einer der klassischen Konkordanztests von der Art Kendall, (Fleiss’) Kappa, Cronbach’s Alpha usw. erst recht angemessen gewesen. Ich verstehe nicht, warum man statt Konkordanz (und nur um die geht es) die absolute Häufigkeit auf Basis einer Normalverteilung testen sollte.

  84. #86 Joseph Kuhn
    6. Mai 2012

    Kleine Zwischenbilanz zum bisherigen Stand der Dinge:
    1. Die der Arbeit zugrunde gelegte Theorie ist selbst nach Aussage des Erstgutachters “abgedreht”. Trotzdem unterbleibt in der Masterarbeit eine angemessene Diskussion über das Verhältnis dieser Theorie zum wissenschaftlichen Konsens, hier den Grundlagen der Physik.
    2. Der Zusammenhang zwischen Theorie, Beobachtungssätzen und Versuchsaufbau ist unklar. Die Schlussfolgerungen der Arbeit sind durch die Daten nicht gedeckt.
    3. Die Präsentation der Daten ist unbefriedigend, die Teststatistik fragwürdig.
    4. Gutachter und Autor interpretieren die Ergebnisse in ihrer Bedeutung für die zugrunde gelegte Theorie diametral entgegengesetzt. Der Autor diskutiert keine alternativen Erklärungen seiner Ergebnisse, die Gutachter bringen in einem offenen Brief eine Alternativerklärung (Hellsehen) ins Spiel, die selbst höchst befremdlich ist.
    5. Die Form der Arbeit ist unwissenschaftlich.
    6. Die Gutachter bewerten die Arbeit als “herausragend”, wehren jede Kritik ab, versuchen das Ganze als Streit über unterschiedliche Wissenschaftskonzeptionen wegzuabstrahieren und empfehlen die Arbeit auch noch für eine Publikation in einem peer reviewten Journal.
    7. Universität, DFG und zuständiges Wissenschaftsministerium schweigen.

  85. #87 Joseph Kuhn
    6. Mai 2012

    Ich muss mich korrigieren. Der Stand der Dinge war gar nicht mehr der Stand der Dinge. Inzwischen hat auch der Zweitgutachter der Masterarbeit, Prof. Dr. Stefan Schmidt, eine Stellungnahme auf der Internetseite des Instituts für transkulturelle Gesundheitswissenschaften veröffentlicht.

    Der Grundtenor dieser Stellungnahme weist eine interessante Nuancierung auf: Die Arbeit wird nun ganz explizit als skeptische Prüfung der Kozyrev-Theorie präsentiert:

    “Unser Masterstudent hatte sich entschlossen, die Theorie des Kozryrev Spiegels, nicht länger zu glauben, sondern wissenschaftlich zu prüfen. Daher hat er sich aufgemacht ein Experiment zu konstruieren und musste beim Erstellen des Studienprotokolls eine Menge über Experimentalmethodik und ihre Fallstricken lernen: Versuchsleitereffekte, korrekte Randomisation, Verblindung und nicht zuletzt Statistik. Aus unserer Sicht, Prof. Harald Walachs und Prof. Stefan schmidts, als betreuende Professoren ein Gewinn. Nur wer die empirische Methode aus eigener Praxis gut kennt, hat auch die Kompetenz andere Facharbeiten zu beurteilen und adäquate Schlussfolgerungen zu ziehen – ein Lernziel des Studiengangs.”

    Und das Ergebnis wird erneut so formuliert:

    “Das Ergebnis des Gesamttestes mit 880 Durchgängen zeigt Resultate wie unter Zufall erwartet. (…) Insgesamt ergibt sich das Bild, dass die Kozyrev-Hypothese nicht bestätigt werden konnte.”

    Wenn das alles so zuträfe und die Arbeit eine gute empirische Prüfung der Kozyrev-Theorie gewesen wäre, hätte sich kein Mensch über diese Masterarbeit aufgeregt. Bestenfalls hätte man den Kopf darüber geschüttelt, dass jemand die Kozyrev-Theorie ernst nimmt und in einem gesundheitswissenschaftlichen Studiengang eine Masterarbeit darüber schreibt.

    Aber dass der Autor der Masterarbeit zur gegenteiligen Bewertung seiner Ergebnisse gekommen ist, wurde bereits oben gesagt und dokumentiert. Da davon auszugehen ist, dass die beiden Gutachter mittlerweilen hier mitlesen, könnte man erwarten, dass sie diese Diskrepanz aufklären. Sie tun es nicht. Auch zu den methodischen und formalen Mängeln der Arbeit gibt es von ihnen kein Wort – obwohl doch “gute Methodik” nach ihrer Meinung das Wesen der Wissenschaftlichkeit ausmacht.

    Die Arbeit wird weiter positiv bewertet, mehr noch, sie wird jetzt sogar mit der Pioniertat Galileo Galileis verglichen:

    “Um zu verstehen was hier für ein Diskurs geführt wird lohnt es sich einen Schritt zurückzutreten und die Dinge aus einer Distanz zu betrachten. Im 17. Jahrhundert stellte Galilei das neu erfundene Fernrohr in Pisa auf und bat die Mitglieder seiner Philosophischen Fakultät hindurchzuschauen, um die Jupitermonde mit einen Augen sehen zu können. Die Antwort der Professoren war eindeutig: Da es theoretisch völlig unmöglich sei, dass es Jupitermonde gebe, sei es unnötig durch das seltsame Rohr zu schauen.”

    Die Hybris dieses Vergleichs einmal dahingestellt, soll das vermutlich bedeuten, diese Masterarbeit könne nur richtig beurteilen, wer selbst mit einem Kozyrev-Spiegels experimentiert. Na prima. Warum nicht gleich nach dem Binnenkonsens für die “besonderen Therapierichtungen” den Binnenkonsens für die “besonderen Wissenschaftsrichtungen” fordern?

    Der Verlauf dieser Sache und die Stellungnahmen der Gutachter machen mich etwas ratlos. Solche Vorgänge sind für die Gesundheitswissenschaften insgesamt nicht gut.

  86. #88 para
    6. Mai 2012

    Irgendwie bin ich gerade fassungslos wenn ich das lese…

    Daher hat er sich aufgemacht ein Experiment zu konstruieren und musste beim Erstellen des Studienprotokolls eine Menge über Experimentalmethodik und ihre Fallstricken lernen: Versuchsleitereffekte, korrekte Randomisation, Verblindung und nicht zuletzt Statistik.

    Bei einer Bachelor-Arbeit eines frischen Studenten kann ich sowas noch nachvollziehen, aber bei einer Masterarbeit eines dipl. med. ?

  87. #89 zwecke
    6. Mai 2012

    fassungsloser noch, macht mich dieser Umstand:
    7. Universität, DFG und zuständiges Wissenschaftsministerium schweigen.
    [Joseph Kuhn· 06.05.12 · 16:38 Uhr]

  88. #91 Sebastian
    7. Mai 2012

    Auch wenn ich in der Sache zustimme – war dieses Nazi-KZ-Totschlagargument wirklich notwendig?

  89. #92 Dr. H.-W. Bertelsen
    7. Mai 2012
  90. #93 G.W.
    7. Mai 2012

    @Joseph Kuhn 06.06 21:31

    Man muss vermutlich zwei Aspekte unterscheiden.

    Zum einen die Arbeit, die haltlos ist. Die zugrundeliegenden Vorstellungen genügen nicht den Anforderungen einer wissenschaftlichen Hypothese oder gar Theorie; sie sind im Lichte des gegenwärtigen, von allen relevanten Forschern vertretenen erfahrungsbasierten und theoriegestützten Wissens der Physik geradezu an den Haaren herbeigezogen und semantische Spielerei, halt typische Esoterik. Die Durchführung ist zwar durchaus bemüht, jedoch naiv. Die Darstellung der Daten und Auswertung sind definitiv insuffizient. Die Diskussion mäandriert ebenso wie die Einleitung durch Literatur, die nicht den elementaren wissenschaftlichen Anforderungen genügt. Das alles ist im besten Fall spekulativ wie die romantische Naturphilosophie, nur dass sich beispielsweise Schelling sprachlich und gedanklich auf anderem Niveau bewegte.

    Zum zweiten das Institut und die beiden Professoren, die sich verständlicherweise bemühen, den Eindruck zu bewahren, dass dort Arbeit geleistet wird, die wissenschaftlich haltbar, legitim oder sogar geboten ist. Daher die Vorwärtsverteidigung, welche in meinen Augen die Grenze weniger zur Hybris als zum Ridikülen überschreitet (wissenschaftliche Diskussionen drehen sich immer um Konkretes, und auch auf dem top level ist es mir nie vorgekommen, dass jemand für nötig erachtete, sich auf Galilei zu berufen). Letztlich bleibt allerdings nach dem Stand der Dinge nur diese Strategie übrig, wenn man nicht seine wissenschaftliche Kompetenz grundlegend in Frage stellen lassen möchte. Kompetenz erweist sich ja nicht alleine im Methodologischen, sondern auch darin, im Vorfeld Fragestellungen zu bewerten und auszuwählen. Offenheit selbst gegenüber den abwegigsten Hypothesen als wissenschaftlich auszugeben ist die einzige Art, die Vergabe des Themas zu rechtfertigen. Und in der esoterischen Szene sind dann eben die Maßstäbe weiter als in der „normalen“ Wissenschaft. Was nur auf den ersten Blick erstaunt, ist der Eindruck, dass offenbar niemals mit führenden Physikern Kontakt aufgenommen wurde, um zu erfahren, ob diese die hypothetischen Phänomene für sinnvoll und prüfbar halten. Hier scheint sich negativ bemerkbar zu machen, dass mit der generalisierten Quantentheorie bereits ein selbstbezüglicher, der Beobachtung beliebig anpassungsfähiger Rahmen geschaffen wurde, welcher die kritische Korrektur von außen überflüssig erscheinen lassen kann.

    Ich möchte es bei diesen Bemerkungen belassen in der Hoffnung, dass Herr Walach aus dem Vorgang gelernt hat und künftig selbstkritischer vorgeht. Ob das alles in der esoterischen Szene als Einschränkung der Wissenschaftsfreiheit deklariert wird, ist insofern unerheblich, als diese Leute ohnedies außerhalb stehen und intellektuell nicht erreichbar sind. Was zählt, ist die Forderung, dass Institutionen, die den Namen einer Hochschule oder Universität tragen, Mindeststandards zu genügen haben, die nicht unterlaufen werden dürfen.

  91. #94 Ponder
    7. Mai 2012

    Mir scheint, den beiden Gutachtern Schmidt und Walach ist immer noch nicht deutlich geworden, dass die fachliche Kritik an dieser Masterarbeit nicht primär dem befremdlichen Thema an sich, sondern der mangelhaften wissenschaftlichen Vorgehensweise gilt.

    Jedenfalls äußert sich Harald Walach heute wie folgt zu der öffentlichen Diskussion:

    …Wissenschaft ist für manche die neue Religion geworden
    Solche Religionen, neue zumal, haben es an sich, dass sie über bestimmte Inhalte definiert sind. Was diesen Inhalten widerspricht, wird ausgegrenzt und verfolgt.
    Dann müssen Worthülsen herhalten, deren mächtigste, weil am wenigsten reflektierte der Begriff „unwissenschaftlich“ ist, gleich danach kommt „esoterisch“.
    Das Problem ist – das hat die wissenschaftshistorische und wissenschaftstheoretische Diskussion der letzten 50 Jahre klar gezeigt – man kann Wissenschaft nicht inhaltlich definieren. Wer das tut, hängt einem veralteten und damit „unwissenschaftlichen“ Begriff von Wissenschaft an. Wäre das die Substanz von Wissenschaft, so hätten wir keinen Fortschritt…

    http://intrag.info/aktuell/2012/05/07/wissenschaft-als-religion-%E2%80%93-religion-und-wissenschaft/

  92. #95 Max
    7. Mai 2012

    Zusätzlich zur oben angeführten berechtigten Kritik der stat. Auswertung (gewählte Tests, Anpassung des Alpha-Fehlers) noch ein Hinweis zur Methodik in der Studie: Es fällt auf, dass bei 880 Versuchen eine Trefferquote von 11 % erreicht wird, was statistisch nicht signifikant aber immerhin erhöht ist. Beim Überfliegen der Arbeit findet man rasch einen möglichen Grund: Es wurden bei der Ziehung von vier Ziffern ein Gesamtset aus jeweils 4 der Ziffern 0-9 verwendet, jeweils aber den Vpn aufeinanderfolgend vier Aufgaben gestellt und hier augenscheinlich das Ergebnis nach jeder Aufgabe veröffentlicht. Dabei verringert sich nach der Ziehung einer Ziffer die Wahrscheinlichkeit, dass diese Ziffer bei den in der Sequenz folgenden Ziehungen wieder erscheint. Zumindest aufgeweckte (nicht erweckte) Vpn sollten deshalb tendenziell die bereits gezogenen Ziffern in der jeweiligen Sequenz mit geringerer Häufigkeit wählen.
    Es handelt sich demnach nicht um eine unabhängige sondern um eine abhängige Ziehung, d.h. während der Ziehung verändert sich die Wahrscheinlichkeit und steigt ausgehend von 10% an. Damit sind sämtliche nachfolgenden Tests, die gegen einen Erwartungswert von 10% prüfen, von vornherein fehlerhaft. Zumindest an dieser Stelle methodisch korrekt wäre es dagegen gewesen, hätte der Autor vier unabhängige Ziffernsets verwendet.
    Da dies weder dem Autor noch den Betreuern der Arbeit aufgefallen zu sein scheint, disqualifiziert dies m.E. den Autor ebenso wie die Betreuer.

  93. #96 G.W.
    7. Mai 2012

    @Max 07.05 18:06

    Wahrscheinlich haben Sie recht. Allerdings ist die Methodenbeschreibung nicht genau genug, um diesen Schluss mit Sicherheit zuzulassen. Da von der Fragestellung keinerlei Notwendigkeit besteht, ein balanciertes Design anzustreben in dem Sinne, dass alle Ziffern gleich häufig in jedem Einzeltest vorkommen oder Wiederholungen auszuschließen wären (im Gegenteil), wäre die Verwendung eines Zufallsgenerators ohnedies angemessen gewesen; so etwas gibt es sogar in EXCEL. Jedenfalls ist erstaunlich, dass es kein Statistikprogramm im Institut zu geben scheint und man auf Internet-Seiten ausweicht, um z-Scores zu berechnen, die sich im Tabellenanhang jedes Lehrbuchs der Statistik befinden. Es gäbe noch weitere ernsthafte methodologische Kritikpunkte, welche die Kompetenz mit großen Fragezeichen versehen. Von der aus den nichtphysikalischen Fingern gesogenen Spiegel-Hypothese ganz abgesehen.

    Herrn Wallach liefert wieder eine der typischen auf Laien berechneten Verteidigungen, bei der die Einzelsätze stimmen oder zumindest diskutierbar sind, jedoch das Gesamte irreführend ist. Das kennt man völlig analog von Kreationisten und Intelligent Design-Anhängern oder auch sogenannten Klima-Skeptikern, die sich gerne als wahre Wissenschaftler gerieren. Im Gegensatz zu der Darstellung seitens Herrn Walach stünde die Forschung tief in der Vergangenheit, würde sie ihre Ressourcen damit vergeuden, jeden offenkundigen Blödsinn zu verfolgen, weil man halt so ungeheuer offen ist. Produktive innovative Ideen befinden sich nie völlig am Rand des Etablierten. Und aus der Richtung von Herrn Walach ist nach meiner Kenntnis noch nie in der Wissenschaftsgeschichte etwas Nennenswertes gekommen.

  94. #97 Ponder
    7. Mai 2012

    Und schon geht es in die Vermarktung!

    Hier Peter Conrad in einem Artikel, den die Firma Metavital

    http://www.metavital.eu/index.html

    zur Vermarktung ihres “Diagnostiksystems Oberon” online stellt:

    Metavital Service GmbH ist im Bereich der Informations- und Naturheilmedizin sowie im Vertrieb und Service des medizinisch zertifizierten NLS (Nicht Lineare Systeme)-Diagnostik-Systems OBERON tätig.
    Metavital Service GmbH bietet mit hoher Kompetenz und Flexibilität ausschließlich Medizinprodukte an und besitzt mehrjährige Erfahrung mit dem NLS-Diagnostik System OBERON. Ständig wachsende weltweite Anfragen führen zur Erweiterung unseres Vertriebs- und Servicenetzes.
    Das Oberon-System wird ausschließlich in Deutschland hergestellt und in Art und Umfang auf die Wünsche und Bedürfnisse der Therapeuten angepasst.
    Von der Metavital Service GmbH erhalten Sie alles aus einer Hand:
    ständige Überwachung bei der Herstellung durch die von deutschen, medizinischen Behörden akkreditierten Unternehmen
    entsprechend hohe Produktqualität
    weltweiter Service
    Ausbildungsprogramme basierend auf mehrjährigen Erfahrungen von vielen Oberon-Anwendern
    Weiterbildungsseminare im Bereich der Informationsmedizin und der NLS-Methode durch erfahrene Dozenten
    ständige Weiterentwicklung im Bereich der NLS-Diagnostik
    Garantie nach europäischen Normen
    Das NLS-Diagnostik-System Oberon wurde in jahrelanger, internationaler Forschungsarbeit entwickelt und basiert auf den Erkenntnissen der Quantenphysik. Das Oberon-System ist ein nicht-invasives Diagnostikverfahren.
    Außer der Diagnostik bietet Oberon noch eine breite Palette von anderen Funktionen, die Ihnen und Ihren Patienten den Weg zu einem harmonischen Gleichgewicht wesentlich erleichtern können.
    Wir sind durch die ständige Suche nach neuen, innovativen Lösungen für die zukünftigen Herausforderungen bestens gerüstet.
    Das Oberonsystem 4021 ist nach Klasse IIa des MPG zugelassen.
    Wir weisen Sie darauf hin, dass die hier vorgestellten Methoden und Systeme, so wie auch ihre Wirkungen in der klassischen Schulmedizin bisher weder wissenschaftlich anerkannt, noch als bewiesen gelten.

    “Wissenschaftliche Begründung” wie folgt:

    http://www.metavital.eu/Artikel_Conrad.pdf

  95. #98 Skeptiker
    8. Mai 2012

    Das Hogwarts an der Oder ;-)
    Wie die Viadrina Pseudowissenschaften willfährig unterstützt.
    Man fasst es nicht
    http://blog.gwup.net/2012/05/07/hogwarts-an-der-oder/

  96. #99 Stefan W.
    8. Mai 2012

    @rolak· 27.04.12 · 20:24 Uhr# , danke, sehr schön.

    @Joseph Kuhn· 29.04.12 · 15:14 Uhr

    Der Fall Guttenberg zeigt das ja zur Genüge.

    Ich bin da nicht so sicher, was der Fall Guttenberg gezeigt hat – ob da Konsens besteht.

    Er hat gezeigt, dass ein umstrittener Politiker ziemlich widerstandsfähig herumgewackelt hat, bevor er gefallen ist. Wer nicht so prominent im Rampenlicht steht ist doch so rasch aus den Schlagzeilen, dass die korrupten Unis das einfach aussitzen.

    Das wäre Punkt 2 dessen, was der Fall gezeigt hat: Ein Sündenbock wird geopfert, aber die Struktur, die den Fall möglich gemacht hat, bleibt unangetastet.

    Der Fall Guttenberg hat m.E. gezeigt, dass die Unis käuflich sind, und die Selbstheilungskräfte nur ausnahmsweise wirken.

    Die Witzfiguren um die es hier geht, die in nichtklassischen Pseudodisziplinen nichtklassische Pseudowissenschaft betreiben sind der folgerichtige, groteske Auswuchs des Systems.

  97. #100 Epicurus
    8. Mai 2012

    Aus dem Arsenal, aus dem auch „absurder Unsinn“ oder „akademische Ungeheuerlichkeit“ stammt, wurde sich rhetorisch immer bedient, wenn es aus Sicht arrivierter Paradigmen galt, wissenschaftliche Revolutionen aufzuhalten. Und es ist nicht selten der erhellendere Teil einer Wissenschaftsgeschichte, der die intellektuellen Anstrengungen beschreibt, die der Verteidigung des Vor-Urteils gegen die Empirie dienten. Im kleinen Maßstab gelten die Verfahren der Alternativ- und Komplementärmedizin Vielen als ein solch satisfaktionsbedürftiger Angriff auf die Vernunft. Die Forderung, ein ganzes Institut zu schließen, weil dort ein „abgedrehtes“ Projekt zur Erforschung alternativer Therapien durchgeführt wird, wurde schon früher gehört. Oft kommen diese Forderungen vor der inhaltlichen Diskussion und Methodenkritik. Zu dem Blog daher drei Gedanken:
    • Wissenschaft ist ein Kulturphänomen, das sich mit den Gesellschaften ändert. Reden über Wissenschaft bedarf daher der Differenzierung nach den Funktionen, die Wissenschaft erfüllt. Z.B. Wissenschaft als Erkenntnisanspruch (1), als Institution (2) oder als methodisches Rational (3). „Moderne“ Wissenschaft unterscheidet sich auf manchen Ebenen von ihren Vorläufern, ohne aber unanfällig für Diskurselemente der Scholastik zu sein. Kulturinvariant aber ist es, dass eine Vermischung der Ebenen Sätze wie „Was aller Vernunft widerspricht, ist keine Wissenschaft“ sinnlos (Ebene 1,2) oder falsch macht (Ebene 3).
    • Ist die in Rede stehende Arbeit wissenschaftlich? Dazu fielen uns etliche Prüfsteine ein, die eigene Ergebniserwartung gehörte aber nicht dazu. Vor solcher Beobachterverzerrung sollte das Untersuchungsdesign schützen. Eine randomisierte, gar verblindete Studie steht an der Spitze der Evidenzhierarchie wissenschaftlicher Untersuchungsdesigns, weil hierdurch das Ziel der Minimierung von Verzerrungen am besten erreicht werden kann. Und würde man mit diesem Design finden, dass ein Apfel nach oben fiele, so bliebe der Befund zunächst bestehen und die Studie verlangte nach Methodenkritik, Reproduktion und Widerlegung nicht nach Übereinstimmung der Ergebnisse mit bestehenden Paradigmen oder Theorien, ja nicht mal Plausibilität.
    • Diese Unabhängigkeit „Guter Methodik“ vom Untersuchungsgegenstand gilt auch für die Wissenschaft im Nationalsozialismus. Dass sich daraus kein Freibrief ergibt, müssen Regeln guter Wissenschaftlicher Praxis sichern (Ebene 2), zu denen auch der informed consent der Versuchspersonen gehört. Und ob Experimente – an Menschen und Tieren – durchgeführt werden können/dürfen, entscheidet z.B. eine Ethikkommission oder – nicht wissenschaftlich! – die Politik. Weder folgen solche normativen Setzungen aus „guter Methodik“, noch können sie hinter dem Vorhalt unwissenschaftlichen Arbeitens versteckt werden. Es gibt eine Vielzahl Radbruchscher Formeln.

  98. #101 Ponder
    8. Mai 2012

    @ Epicurus:

    Auf Ihre Überlegungen und Fragen, insbesondere

    • Ist die in Rede stehende Arbeit wissenschaftlich?

    Dazu fielen uns etliche Prüfsteine ein, die eigene Ergebniserwartung gehörte aber nicht dazu. Vor solcher Beobachterverzerrung sollte das Untersuchungsdesign schützen. Eine randomisierte, gar verblindete Studie steht an der Spitze der Evidenzhierarchie wissenschaftlicher Untersuchungsdesigns, weil hierdurch das Ziel der Minimierung von Verzerrungen am besten erreicht werden kann. Und würde man mit diesem Design finden, dass ein Apfel nach oben fiele, so bliebe der Befund zunächst bestehen und die Studie verlangte nach Methodenkritik, Reproduktion und Widerlegung nicht nach Übereinstimmung der Ergebnisse mit bestehenden Paradigmen oder Theorien, ja nicht mal Plausibilität.

    gibt vermutlich dieser Blogbeitrag dezidiert Antwort:

    http://www.scienceblogs.de/astrodicticum-simplex/2012/05/pseudowissenschaft-an-der-europauniversitat-viadrina-frankfurt-harald-walch-und-der-kozyrevspiegel.php

  99. #102 Daniel Elstner
    8. Mai 2012

    So langsam geht mir dieser pseudophilosophische Aufguss wirklich auf die Nerven.

    Aus dem Arsenal, aus dem auch „absurder Unsinn“ oder „akademische Ungeheuerlichkeit“ stammt, wurde sich rhetorisch immer bedient, wenn es aus Sicht arrivierter Paradigmen galt, wissenschaftliche Revolutionen aufzuhalten.

    Nehmen wir mal der Argumentation halber an, Ihre Interpretation der Wissenschaftsgeschichte wäre korrekt. Dann würde aus “A wurde gesagt, um B zu erreichen” trotzdem noch nicht “immer wenn A gesagt wird, ist das Ziel B”.

    Und es ist nicht selten der erhellendere Teil einer Wissenschaftsgeschichte, der die intellektuellen Anstrengungen beschreibt, die der Verteidigung des Vor-Urteils gegen die Empirie dienten.

    Wenn wir gerade bei Empirie sind: Haben Sie sich inzwischen entschieden, ob die Arbeit die These nun bestätigt oder widerlegt? (Ich schließe aus dem später auftauchenden “uns” in Ihrem Text, dass Sie als Vertreter des IntraG hier sind.) Welche empirischen Befunde werden von unserer Seite aus Ihrer Ansicht nach geleugnet?

    Die Forderung, ein ganzes Institut zu schließen, weil dort ein „abgedrehtes“ Projekt zur Erforschung alternativer Therapien durchgeführt wird, wurde schon früher gehört.

    Die Forderung begründet sich aus der Wahrnehmung, dass die Herangehensweise und Qualität der Masterarbeit symptomatisch für die Arbeit am IntraG insgesamt zu sein scheint. Im übrigen ist mir nicht klar, inwiefern die besprochene Masterarbeit “alternative Therapien” erforscht.

    Oft kommen diese Forderungen vor der inhaltlichen Diskussion und Methodenkritik.

    Unabhängig von der Reihenfolge wäre es wünschenswert, wenn abseits allgemeiner kulturkritischer Erwägungen seitens des IntraG auf die geäußerte Kritik eingegangen würde. Bis jetzt erschöpft sich die Reaktion in der Behauptung, dass die Kritiker die Arbeit angeblich nicht gelesen hätten und in ihr etwas ganz anderes stünde als behauptet. Die Aussage seitens Prof. Dr. Dr. Walach, dass die Arbeit skeptischer Natur sei und die These angeblich widerlegen würde, ist eine glatte Lüge. Zumindest, wenn man die Auswertung des Autors selbst hier als maßgeblich erachtet.

    Unabhängig von wissenschaftstheoretischen Erörterungen und dem Thema der Arbeit sollte an dieser Stelle festgehalten werden, dass ein derartiger Umgang mit Kritik menschlich völlig unakzeptabel ist. Nochmal: dreiste Lügen über trivial nachprüfbare Fakten (der Inhalt der Arbeit), und das von einem Institutsleiter an einer Universität — das geht sowas von überhaupt nicht!

    Eine randomisierte, gar verblindete Studie steht an der Spitze der Evidenzhierarchie wissenschaftlicher Untersuchungsdesigns, weil hierdurch das Ziel der Minimierung von Verzerrungen am besten erreicht werden kann.

    Es ist schön, dass wir uns zumindest über den Wert (doppelt) verblindeter, randomisierter Studien einig sind. Wenn Sie allerdings ernsthaft weiter behaupten wollen, dass die konkrete Durchführung in diesem Fall von guter Qualität sei, dann haben Sie entweder einen äußerst niedrigen Qualitätsanspruch oder Sie verarschen uns einfach nur.

    Und würde man mit diesem Design finden, dass ein Apfel nach oben fiele, so bliebe der Befund zunächst bestehen und die Studie verlangte nach Methodenkritik, Reproduktion und Widerlegung nicht nach Übereinstimmung der Ergebnisse mit bestehenden Paradigmen oder Theorien, ja nicht mal Plausibilität.

    Es geht weniger um bestehende Paradigmen und Theorien, sondern mehr um die Tatsache, dass alle anderen beobachteten Äpfel herunterfallen. Also entgegen Ihrer Selbstdarstellung geht es nicht um Dogma vs Empirie, sondern um Empirie vs Empirie. Es läge an Ihnen, auszuarbeiten, was Ihren Apfel oder Ihre Umgebung so besonders und vor allem unterscheidbar macht, um sie mit den vorherigen empirischen Erkenntnissen in Einklang zu bringen. Mal so eben im Vorbeigang scheinbar die halbe bekannte Physik zu widerlegen und dann so tun, als ob daraus keine Konsequenzen erwachsen würden, dass geht einfach nicht. Für jemanden, der meint, gerade an einer wissenschaftlichen Revolution teilzuhaben, wirken Sie seltsam unbeteiligt.

    Was an dem Satz „Was aller Vernunft widerspricht, ist keine Wissenschaft“ sinnlos sein soll, erschließt sich mir auch nicht. Würden Sie zustimmen, dass die wissenschaftliche Methodik auf dem Boden der Vernunft steht?

  100. #103 G.W.
    8. Mai 2012

    @epicurus 08.05 14:05

    Danke für Ihre Ratschläge. Sie fahren allerdings im Wesentlichen, teils in adornitischem Stil, nur das rhetorische Arsenal auf, das Wissenschaftsverschleierer verwenden, und verbleiben wohlweislich im diffus Allgemeinen. So stellt sich die Frage, warum man denn eigentlich nicht die „konventionelle“ Wissenschaft auf sich beruhen belässt und der alternativen, erweiterten usw. einen neuen Namen gibt. Warum das Bestreben, von der Bezeichnung als „Wissenschaft“ beim (zahlenden) Publikum (darum geht es, nicht die Wissenschaftler) zu profitieren, wenn das Gewicht der Wissenschaft auf ihrem methodisch geprüften Erfahrungsfundus und einer theoretischen Durchdringung beruht, deren Standards unterlaufen werden? Dass in concreto die Arbeit gravierende, ja annihilierende methodische Mängel aufweist, wurde bereits dargelegt. Die statistische Auswertung beispielsweise wirft die Frage auf, ob jemals ein Lehrbuch der Statistik in Sichtweite kam.

    Um es kurz zu machen:
    1. Man reproduziere die Studie, wenn man sie für einen Hinweis hält. Aber bitte nicht hobbymäßig, sondern unter nachvollziehbaren kontrollierten Bedingungen (analog zu GMP).
    2. Gerne erwarte ich aus dieser Richtung eine der großen wissenschaftlichen Revolutionen, die aus der „Sicht arrivierter Paradigmen“ aufgehalten werden. Stehen solche Revolutionen nicht seit Mesmer an und sind doch nicht gekommen? Was hat im Übrigen Zahlenerraten mit Diagnose, dem Erfolg von Therapie usw. zu tun? Warum sollte ein gefundener Zusammenhang übertragbar sein? Weil alles irgendwie zusammenhängt?
    3. Was ist der „erhellendere Teil einer Wissenschaftsgeschichte, der die intellektuellen Anstrengungen beschreibt, die der Verteidigung des Vor-Urteils gegen die Empirie dienten“ in der Anwendung auf den vorliegenden Fall? Betreiben die Wissenschaftler, die tatsächlich etwas von Quantentheorie verstehen und die Quantenlaunigkeiten, um die es hier geht, für vaniloquentia halten, intellektuelle Anstrengungen gegen die Empirie? Wenn ja, welche Empirie?

  101. #104 Dr. Webbaer
    8. Mai 2012

    Joseph Kuhn wirkt. ;-)

    MFG + weiterhin viel Erfolg
    Dr. Webbaer

  102. #105 Joseph Kuhn
    8. Mai 2012

    @ Empiricus:

    1. Dass Wissenschaft ein “Kulturphänomen” ist, ist trivial. Vor der Entwicklung der menschlichen Kultur gab es keine Wissenschaft. Dass Wissenschaft irgendwie kulturabhängig ist, ist auch trivial. Ihre Methoden und Erkenntnisse entwickeln sich historisch, manche Methoden z.B. in Abhängigkeit von technischen Möglichkeiten, diese wiederum in Abhängigkeit von gewonnenen Erkenntnissen. Inwieweit wissenschaftliche Erkenntnisse “kulturrelativ” im Sinne einer unaufhebbaren kulturellen Perspektivität sind, ist eine interessante Frage. Das kann man kontrovers diskutieren, es hat nur nichts mit der hier diskutierten Masterarbeit zu tun.
    2. Niemand will hier “arrivierte Paradigmen” verteidigen. Egal, welches Wissenschaftsparadigma man vertritt: die Masterarbeit ist unwissenschaftlich. Man muss sie allerdings wenigstens einmal ansehen. Das ist ja auch der Anspruch Walachs: die Phänomene ernstnehmen. Die Masterarbeit ist ein solches Phänomen. Also: Ansehen!
    3. “Ergebniserwartung” und “Beobachterverzerrung” sind zwei verschiedene Dinge. Auch in der Mathematik habe ich eine Ergebniserwartung, dass 2 + 2 = 4 ist. Wenn meine Rechnung davon abweicht, suche ich nach einem Fehler in der Rechnung, weil viel an bisherigen Erkenntnissen für die “Ergebniserwartung 4″ spricht. Wenn etwas gegen eine “Ergebniserwartung: Kozyrev-Theorie ist falsch” spricht, muss ich auch überlegen, ob die Last bisheriger Erkenntnisse nicht zunächst zur Fehlersuche animieren sollte. Eine “Beobachterverzerrrung” dürfte daher wohl eher beim Autor der Masterarbeit festzustellen sein.
    4. Darüber, ob “gute Methodik” alleine Wissenschaftlichkeit konstituieren kann, habe ich jetzt mehrfach etwas geschrieben. Ich will mich nicht ständig wiederholen. Das begründete Ergebnis war: Nein, “gute Methodik” alleine kann Wissenschaftlichkeit nicht konstituieren. Aber auch hier gilt: Selbst wenn es so wäre, die Masterarbeit ist damit nicht gerettet. Sie ist ein Beispiel für schlechte Methodik, auch das wurde hier zur Genüge ausgeführt, u.a. in den Kommentaren von G.W.
    5. “Wissenschaft als Erkenntnisanspruch” und “Wissenschaft als Institution” sind normativ nicht zu trennen. Im Reliabilismus, einer erkenntnistheoretischen Richtung, wird beides sogar in einen systematischen Zusammenhang gebracht: Demnach ist eines der Merkmale für “Wissen”, dass die Quellen verlässlich sind, diese Verlässlichkeit soll heute das Wissenschaftssystem (die Institution Wissenschaft) mit seinen Prozuduren gewährleisten. Das leistet das Wissenschaftssystem empirisch natürlich oft nicht. Die Masterarbeit ist dafür ja ein schönes Beispiel und das macht zugleich deutlich, warum es für Wissenschaft “als Erkenntnisanspruch” so wichtig ist, das korrekte Funktionieren von Wissenschaft “als Institution” zu bewahren.
    6. Warum wird eigentlich diese Masterarbeit so vehement unter Aufbietung so vieler wissenschaftstheoretischer Argumente verteidigt? Warum schaut man sie nicht in Ruhe an und räumt dann ein: o.k., das war wohl nichts? Mit welcher Art von “Ergebniserwartung” hat man es hier zu tun? Dass nicht sein kann, was nicht sein darf, nämlich dass diese Arbeit einfach Mist ist?
    7. Eine bisher nicht gestellte Frage, auf die mich ein Kollege hinwies: Was qualifiziert diese Arbeit überhaupt als “gesundheitswissenschaftliche Arbeit”? Ist sie nicht eher eine Arbeit aus dem Gebiet der Physik? Wenn ja, ist ein gesundheitswissenschaftliches Institut dafür der richtige Ort (d.h. eine verlässliche Quelle des Wissens im Sinne des Reliabilismus)?

  103. #106 G.W.
    8. Mai 2012

    @Joseph Kuhn

    Danke für Ihre ausführliche Stellungnahme, der ich nichts hinzuzufügen habe außer Folgendem.

    Die Arbeit ist auch keine der Physik, da dafür alle Voraussetzungen fehlen. Sonst wäre eine psychologische Arbeit, die (ggf. selbstprogrammierte) computerisierte Tests verwendet, eine Arbeit der Computerwissenschaften. Es ist eine psychologische bzw. parapsychologische Arbeit. Denn Zahlenerraten hätte selbst dann, wenn es funktionierte, primär nichts Ersichtliches mit Medizin zu tun. Aber da hilft dann ggf. wieder die verallgemeinerte Theorie, um schließlich beim Kosmos anzulangen.

    Kennzeichen von Wissenschaft ist das Konkrete, Kennzeichen von Parawissenschaft die Flucht ins Universelle. Wenn ein Gutachter einen meiner eingereichten Artikel hinsichtlich Fragestellung und Methode kritisiert, werde ich mich als Autor lächerlich machen, falls ich auf Kopernikus, Galilei, Paradigmata, Szientismus usw. Rekurs nehme statt konkret zu argumentieren. Stellt man die methodologischen Mängel einmal zurück, zeigt die Arbeit bei voller Verblindung ein Zufallsergebnis. That’s it. Wer das nicht glaubt, soll bitte die Studie besser und kontrolliert wiederholen statt pseudowissenschaftshistorisch und -philosophisch herumzueiern.

  104. #107 Joseph Kuhn
    8. Mai 2012

    @ G.W.: So ist es.

  105. #108 Joseph Kuhn
    9. Mai 2012

    @ Epicurus:

    Kleiner, nicht ganz ernst gemeinter Nachtrag:

    “Aus dem Arsenal, aus dem auch „absurder Unsinn“ oder „akademische Ungeheuerlichkeit“ stammt, wurde sich rhetorisch immer bedient, wenn es aus Sicht arrivierter Paradigmen galt, wissenschaftliche Revolutionen aufzuhalten.”

    Alternative: Aus dem Arsenal, aus dem auch “Kritik” oder “Problem” stammt, wurde sich rhetorisch immer bedient, wenn es aus Sicht arrivierter Paradigmen galt, wissenschaftliche Revolutionen aufzuhalten.

    Oder, was auch gut geht:

    Aus dem Arsenal, aus dem auch “aber” oder “nein” stammt, wurde sich rhetorisch immer bedient, wenn es aus Sicht arrivierter Paradigmen galt, wissenschaftliche Revolutionen aufzuhalten.

    @ Stefan W.:

    Mit Ihrer Differenzierung zum Fall Guttenberg haben Sie sicher recht. Nicht unwahrscheinlich, dass die Sache von den Frankfurtern (wieder einmal) ausgesessen werden kann.

    @ Daniel Elstner:

    Epicurus ist kein Vertreter des INTRAG, sondern eigentlich ein ausgesprochen kluger Kopf (wir mailen auch direkt, daher weiß ich, wer es ist). Ihn reitet tatsächlich ein erkenntnistheoretischer Fundamentalismus, der geht hier aber an der Sache vorbei.

    @ alle:

    Florian Freistetter hat nebenan das Thema auch aufgegriffen, mit ganz interessanten Kommentaren auch noch einmal zur Methodenfrage.

    In “Der Standard, einer österreichischen Tageszeitung, gibt es ebenfalls einen Beitrag.

  106. #109 Joseph Kuhn
    9. Mai 2012

    Und noch ein Update zum Stand der Dinge:

    Herr Walach hat eine neue Stellungnahme abgegeben.

    Er stilisiert die Verteidigung der Masterarbeit erneut als Verteidigung der Wissenschaftsfreiheit gegen eine scientistische Religion. Sehr witzig.

    Aufschlussreich ist seine neue Definition für “Wissenschaftlichkeit”:

    “Was entscheidet dann, was wissenschaftlich ist? Die Tatsache, ob Befunde publizierbar sind, die Resonanz, die sie in der wissenschaftlichen Gemeinschaft finden und damit die Aufmerksamkeit von Kollegen zu erwecken und diese zu weiterer Arbeit zu inspirieren.”

    Damit sind wir dann endgültig bei dem oben von mir ironisch eingeführten Vorschlag, einen “Binnenkonsens für besondere Wissenschaftsrichtungen” einzuführen, angelangt. Publizieren kann die Eso-Szene schließlich, Resonanz findet sie ausreichend und offensichtlich inspirieren solche Arbeiten auch immer wieder “weitere Arbeit”. Die Kritik, die eine Arbeit in der wissenschaftlichen Gemeinschaft erfährt, entscheidet demnach jedenfalls nicht darüber, ob etwas wissenschaftlich ist.

  107. #110 Daniel Elstner
    9. Mai 2012

    @Epicurus: Da Sie entgegen meiner ursprünglichen Annahme kein Vertreter des INTRAG sind, entschuldige ich mich für meine harten Anwürfe Ihnen gegenüber.

    An Herrn Walach gerichtet kann der Text jedoch so stehenbleiben.

  108. #111 Ponder
    9. Mai 2012

    @ Joseph Kuhn:

    …Damit sind wir dann endgültig bei dem oben von mir ironisch eingeführten Vorschlag, einen “Binnenkonsens für besondere Wissenschaftsrichtungen” einzuführen, angelangt. Publizieren kann die Eso-Szene schließlich, Resonanz findet sie ausreichend und offensichtlich inspirieren solche Arbeiten auch immer wieder “weitere Arbeit”. Die Kritik, die eine Arbeit in der wissenschaftlichen Gemeinschaft erfährt, entscheidet demnach jedenfalls nicht darüber, ob etwas wissenschaftlich ist…

    Ich schlage daher vor, analog zur “Alternativmedizin” den Terminus “Alternativwissenschaft” (bitte nicht “Komplementär-W.”!) für solche Fakultäten und deren Forschung einzuführen.

  109. #112 Adent
    9. Mai 2012

    @Ponder
    Bin voll einverstanden, würde aber noch eins der beiden binnen t´s aus Alternativwissenschaft streichen, welches bleibt ihnen überlassen.

  110. #113 Ponder
    9. Mai 2012

    Ungeachtet dieser Peinlichkeiten wird schon nach weiteren öffentlichen Fördermitteln geschielt:

    …Insgesamt begegnete die Politik der Forderung nach Aufnahme komplementärer Verfahren in den Leistungskatalog der GKV – aufgrund der bekannten Potentiale zum Beispiel in der Prävention und auch in der Palliativmedizin – mit dem Verweis auf den zu erbringenden Wirksamkeitsnachweis. Trotzdem hieß es: „Die Instrumentarien des Gemeinsamen Bundesausschusses können aber durchaus politisch überprüft werden.“

    Zum Thema Wirksamkeitsnachweis wurde aber auch im Austausch mit dem Plenum deutlich, dass es eben keine Chancengleichheit bei den Rahmenbedingungen für konventionelle und komplementäre Medizin bzw. für die komplementärmedizinische Forschung gibt. Alle Lehrstühle für Komplementärmedizin sind in Deutschland stiftungsfinanziert. Dazu Maria Klein-Schmeink: „Warum hier nicht besondere Budgets bereitstellen? In anderen Bereichen werden Innovationen ja auch gesondert gefördert.“ Eine Anregung, die sinnvoll erscheint und die mit spontanem Applaus begrüßt wurde.

    Quelle:

    http://www.cam-media-watch.de/?p=6899

    Solcherlei Ansinnen muss man angesichts dieser “Masterarbeit” und ähnlicher “Forschungstätigkeit” bzw in Kenntnis des von Herrn Walach nun geoffenbarten absonderlichen Wissenschaftsverständnisses energisch entgegen treten!

  111. #114 Dr. Webbaer
    9. Mai 2012

    Aber Neu-Szientisten, die selber nichts zur Wissenschaft beitragen, sollen nach meinem Dafürhalten nicht den Diskurs darüber bestimmen, was Wissenschaft ist, sondern das denen überlassen, die Wissenschaft betreiben. (Quelle)

    Da scheint Herr Harald Walach schon ein wenig angefressen zu sein. – Seine Verteidigungsrede gegen die bösen ‘Szientisten’, nein ‘Neu-Szientisten’!, also gegen die aus seiner Sicht wissenschaftlich ganz Fruchtlosen fällt blumig und schwach aus, wie der Schreiber dieser Zeilen findet.

  112. #115 Ponder
    9. Mai 2012

    @ Webbär:

    Ach, das ist alles kalter Kaffee!

    Die Verantwortlichen des CAM-Studiengangs fühlen sich schon länger verfolgt – von bösen Journalisten und “fundamentalistischen Skeptikern”.
    Dazu hier der Begründer des CAM-Studiengangs, Hartmut Schröder (Linguist!), auf frühere Negativschlagzeilen bezogen:

    …Warum also trotzdem diese – im wahrlich doppelten Sinne – schlechte Presse über die komplementäre Medizin, die nicht nur mehrheitlich von Patienten nachgefragt und von mehr als einem Drittel der niedergelassenen Ärzte praktiziert wird sondern durch zahlreiche Lehrstühle und Studiengänge an den Hochschulen in den letzten Jahren endlich die zweifellos notwendige akademische Qualitätssicherung erhält?

    Da ich an der Konzipierung des Masterstudiengangs „Komplementäre Medizin – Kulturwissenschaften– Heilkunde“ an der Europa-Universität Viadrina beteiligt war und in diesem Studiengang auch lehre, erlaube ich mir in die Kampagne einzugreifen, die Sebastian Herrmann mit seinem Beitrag „Magie im Hörsaal“ in den Medien losgetreten hat.
    Dabei sehe ich in dieser einseitigen Kampagne durchaus eine Chance, wenn sie sich in Richtung einer wirklichen Debatte weiterentwickelt. Verzichten werde ich daher auf jede Polemik, die natürlich durchaus möglich wäre.
    Nur zwei Hinweise seien meinen Ausführungen vorweggeschickt, damit der Kontext des Ganzen deutlich wird:
    Bevor sich überhaupt die Medien mit der Thematik beschäftigten hat die „Gesellschaft zur wissenschaftlichen Untersuchung der Parawissenschaften“ (GWUP), die sich anschickt die moderne Inquisition zu werden, mit gezielten Verleumdungskampagnen das Feld bereitet. Dafür dass diese Gesellschaft und ihre Zeitschrift Der Skeptiker es nicht so genau mit der Wahrheit halten sowie mit gezielten Rufmordversuchen in Verbindung gebracht werden finden sich erdrückend viele Hinweise. Dass seriöse Journalisten aus dieser Ecke ihre Vorlagen holen spricht leider nicht für professionelle Recherchen…

    Quelle:
    http://www.homotox.de/cms/docs/doc51779.pdf

    Das Wissenschaftsministerium Brandenburg hat übrigens eine eigene Facebookseite, und dort gibt es seit Montag einen Link zum aktuellen SPIEGEL-Artikel über die Masterarbeit, bislang allerdings noch unkommentiert:

    http://de-de.facebook.com/Brandenburg.MWFK

  113. #116 Dr. Webbaer
    9. Mai 2012

    @Ponder
    Das ist kein Zufall, das hat System, gell.
    Ist der Eindruck des Webbaeren richtig, dass hier “multikulturell” was gedreht werden soll, dass Standards allgemein aufgeweicht werden sollen?:
    http://www.scienceblogs.de/gesundheits-check/2012/04/wissenschaftstheorie-wissenschaftspraxis-wissenschaftspolitik-die-unendliche-geschichte-esoterischer-betatigungen-an-der-viadrina.php#comment324083

    MFG
    Wb

  114. #117 Ponder
    9. Mai 2012

    @ Webbaer:

    Ja, hat System, und definitiv sollen Standards unterlaufen werden.

    Ulrich Berger hatte vor einiger Zeit dazu schon gebloggt:

    http://www.scienceblogs.de/kritisch-gedacht/2010/12/akademische-esoterik-der-fall-viadrina-13.php#comment166906

    In den Kommentaren finden sich noch viele Hinweise, auch zu den geplanten Begleitstrukturen.

    Einer der Hauptbetreiber dieser “Zuliefer-Betriebe” bzw des Anliegens, medizinische Assistenzberufe aufzuwerten (Begründung: sie hätten “Erstkontakt” zu Patienten und seien in dieser Hinsicht Ärzten gleich zu stellen) ist der Medizinjurist Boxberg, der in Hartmut Schröders pdf besonders erwähnt wird.

    http://www.europa-uni.de/de/forschung/institut/institut_intrag/masterstudiengang/Downloads/StellungnahmDrBoxberg.pdf

    Hartmut Schröder selbst (der – damals zumindest – über keinerlei medizinische oder psychotherapeutische Qualifikation verfügte) hatte in Süddeutschland eine Jodeldiplomschmiede, in der er u.a. seine Ausbildung zum “Klangtherapeuten” anbot (Seminar auf Kos oder La Gomera…) – das Klangtherapie-Modul unter seiner Leitung gehört im Rahmen des Angebots “Biologische Schmerzmedizin” immer noch zum Syllabus des CAM-Studiengangs.

    An dieser Jodeldiplom-Akademie (in Stuttgart?) konnte man alle möglichen “therapeutischen” Ausbildungen absolvieren, die vermutlich u.a. auch dazu qualifizieren sollten, anschließend einen Masterstudiengang Komplementärmedizin draufzusetzen.
    Keine Ahnung, ob es dieses Etablissement noch gibt – vermutlich hat es nur seinen Anstrich gewechselt.

    Solchem Unsinn kann man nur begegnen, indem der Begriff “Therapeut” endlich staatlich geschützt wird.

    Sehr lustig und bezeichnend für das ganze Theater:

    Auf der von mir kürzlich erwähnten FB-Seite des Wissenschaftsministeriums scheint die Info über den SPIEGEL-Artikel schon gelöscht zu sein.
    Es ist also offenbar nicht erwünscht, dass dort kommentiert wird :D

  115. #118 Dr. Webbaer
    9. Mai 2012

    Keine Ahnung, ob es dieses Etablissement ['Jodeldiplom-Akademie'] noch gibt (…)

    Höchst amüsant!, Sie sind nicht zufällig mit Ponder aus den Scheibenweltromanen identisch? – Hmm, ansonsten, also auch in des G-Wissenschaften ist man ja heutzutage oft esoterisch unterwegs, das fing so in den Siebzigern an, als auf einmal jeder kommen konnte, die Sache ist dann nach und nach ins “Gefühlslinke” (vs. Traditionslinke) umgeschwenkt, wenn Sie mal Zeit haben könnten Sie einen Blick auf die sog. Vorurteilsforschung werfen; nur wenig ist lustiger.

    MFG
    Dr. Webbaer

  116. #119 Ponder
    9. Mai 2012

    @ Webbaer:

    Sie sind nicht zufällig mit Ponder aus den Scheibenweltromanen identisch?

    Sie meinen den hier?

    http://wiki.lspace.org/wiki/Ponder_Stibbons

    Klar! ;-)

    (Einer muss ja die Fleißarbeit machen…)

    Hier ist übrigens so ein Institut (wenn auch nicht das “Original”) , und Hartmut Schröder ist auch mittenmang dabei!

    http://www.dil-online.de/Bildungsangebot/Klangtherapeut-Ausbildung.html

    Es gibt übrigens einen neuen Blogbeitrag zu Harald Walachs im wahrsten Sinne des Wortes ab-sonderlichen Wissenschaftsverständnis:

    http://blog.esowatch.com/?p=7709

  117. #120 Ponder
    9. Mai 2012

    Noch mal zum Aufweichen von Standards und Dr. Ernst Boxberg (Dozent für Medizinrecht beim CAM-Studiengang Viadrina):

    http://www.stw.de/transfer/su-profile.html?filialnummer=1426

    Dazu passt auch folgende Meldung:

    …Nicht einzusehen sei zudem, warum Versicherte immer nur von approbierten Ärzten behandelt werden müssen. „Es gibt viele Bereiche, in denen Angehörige anderer Gesundheitsberufe dieselben oder sogar bessere Behandlungsentscheidungen treffen können“, so das Credo des Wissenschaftlers. So könne auch ein Optiker eine Sehschwäche diagnostizieren und nicht nur der Augenarzt, Physiotherapeuten und Logopäden wüssten oft sogar besser, welche Therapien ein Schlaganfall-Patient benötige, als dessen behandelnder Arzt. „Wenn wir die therapeutische Hoheit in Teilen auf andere Leistungserbringer als die Ärzte verlagerten oder zumindest besser kooperiert würde, könnte dies die Qualität verbessern und die Kosten senken“, ist Glaeske überzeugt.


    Gesundheitsreform: Gerd Glaeske: Auch Millionäre müssen in die Kasse – weiter lesen auf FOCUS Online: http://www.focus.de/finanzen/versicherungen/krankenversicherung/tid-18684/gesundheitsreform-gerd-glaeske-auch-millionaere-muessen-in-die-kasse_aid_520576.html

  118. #121 P
    9. Mai 2012

    Und weiter gehts – eine ganze Reihe von Informationsveranstaltungen unter der Schirmherrschaft einer Krankenkasse:

    Gesundheitsuniversität für Alle

    Eisenhüttenstadt/Frankfurt (Oder), 26.03.2012

    Gesundheitsuniversität für Alle

    Brandenburgische BKK, Europa-Universität Viadrina und Privatarztpraxis Schöneberg bieten gemeinsame Vorlesungen zur Prävention und Gesundheitsförderung an

    Homöopathie, Akupunktur, Blutegel – alternative Heilverfahren boomen. Mittlerweile bietet jede dritte medizinische Hochschule in Deutschland Homöopathie als Wahlpflichtfach ihren Studenten an. Fertig ausgebildete Ärzte, Apotheker und Psychotherapeuten, die mehr davon wollen, können an der Europa-Universität Viadrina in Frankfurt (Oder) am Institut für transkulturelle Gesundheitswissenschaften einen Masterstudiengang belegen.

    Das Institut betont die geisteswissenschaftlichen Wurzeln der Medizin und Heilkunde. So sollen Apotheker, Ärzte, Psychotherapeuten besser vernetzt werden und sich zusätzliches Wissen und ergänzende Qualifikationen aneignen, die über das im jeweiligen Fachstudium Vermittelte hinausgehen.

    Nun öffnet die Viadrina Ihre Tore und bietet gemeinsam mit der Brandenburgischen BKK und der Privatpraxis Schöneberg eine Vorlesungsreihe für alle Bürger an. Sechs Mal im Jahr will die „Gesundheitsuniversität“ aufklären über Prävention und Gesundheitsförderung.

    „Wir wollen Möglichkeiten zum Schutz vor chronischen Krankheiten vorstellen“, sagt Kathrin Wormann. Die BKK Chefin arbeitet in diesem Projekt unter anderem mit Harald Walach zusammen. Der Professor für Forschungsmethodik komplementärer Medizin und Heilkunde sorgt sich um die geistige Hygiene…

    http://www.brandenburgische-bkk.de/unternehmen/presse/190-gesundheitsuniversitaet-fuer-alle

    Bevor sich Walach um die “geistige Hygine” sorgt, sollte er sich lieber über die von ihm gelehrte und zu verantwortende Forschungsmethodik sorgen!

  119. #122 G.W.
    9. Mai 2012

    @P 19:02

    Die esoterische Paramedizin (darum handelt es sich ja) wird im eigentlichen Felde der Wissenschaft nach aller Wahrscheinlichkeit nicht Fuß fassen können. Auch bezweifle ich, dass die DFG usw. so etwas jemals fördern werden. Anders sieht es vielleicht mit mehr politisch-weltanschaulich motivierten Förderern aus. Ferner reüssiert man in der Wissenschaft nicht mittels Prinzipienkämpfen und Galilei-Pose, sondern mit konkreter, solider Arbeit.

    Aber darum geht es vermutlich gar nicht, sondern um viel Banaleres, um eine in den Augen medizinischer Laien und Politiker überzeugende Argumentation, die sich in politische und vor allem ökonomische Entscheidungen umsetzt.

    Diejenigen, die in die Ausbildung investiert haben, wollen ja auch Geld verdienen, und es werden immer mehr. Privat zu begleichende, von den Krankenkassen nicht übernommene Rechnungen sind auf Dauer kein Weg, zumal nicht damit zu rechnen ist, dass die „Mittelklasse“ auf Dauer immer mehr Geld zur Verfügung haben wird; die Einkommensschwachen dürften von untergeordneter Bedeutung sein. Da bietet es sich an, an Kassenleistungen zu gelangen, weil dann auch diejenigen, die nichts von der Sache halten, mitbezahlen, und vielleicht einmal, weil sie ja mitbezahlen, selbst die Sache ausprobieren.

    Die Kassen ködert man heute sehr gut mit der Aussicht auf Kostensenkung. Das geht zum einen über Vorsorge, ganz gleich ob die effektiv ist, zum anderen dadurch, dass man minder qualifizierte Interventionen inkl. Personal als ausreichend erklärt. Das Beispiel Augenoptiker versus Augenarzt klingt ja zunächst überzeugend, auch wenn es für andere als relativ banale Visusstörungen schon nicht mehr stimmt. Zugleich hat man es hier mit klar definierbaren und behandelbaren Störungen zu tun. Anders in der Paramedizin. Man ersetze nur Augenoptiker durch Homöopath usw. und Augenarzt durch, sagen wir, Kardiologen, um das zu sehen.

    Das Resultat wird erstens in summa eine Kostensteigerung sein (die vermutlich kaschiert wird, indem der Leistungskatalog an anderen, sinnvollen Stellen gekürzt wird). Weder dürfte Homöopathie billiger sein noch steht zu erwarten, dass sie konventionelle medizinische Interventionen bei chronisch kranken Patienten, die einen wesentlichen Teil der Kosten verursachen, überflüssig macht. Stelle ich mir dann diese Leute losgelassen auf Diabetiker oder Patienten mit kardiovaskulären oder respiratorischen etc. Erkrankungen vor, dann wird mir angst und bange; die Grenzziehung wird ja schwierig und diese Patienten wollen schließlich auch, was andere bekommen. Im Übrigen dürfte die Bereitschaft zu einer Dauermedikation (Compliance), welche chronische Erkrankungen teils auch bei nur leicht- oder mittelgradigen Formen erfordern, eher abnehmen, da das Pharma-Teufelszeug ja die guten homöopathischen Effekte mindert. Beim Asthma beispielsweise ist die mangelhafte Bereitschaft zur Einnahme inhalierter Kortisonpräparate allgemein bekannt, und man weiß seit etlichen Jahren, dass eine reine bronchialerweiternde Bedarfsmedikation mit einer erhöhten Sterblichkeit einhergeht. Ich sehe schon die glorreichen Zeiten einer signifikanten Asthma-Mortalität wieder aufziehen.

    Meines Erachtens gilt es aus Gründen der medizinischen Versorgung sowie aus Kostengründen dieses Eindringen zu verhindern. Homöopathie etc. ist in meinen Augen larvierte Psychotherapie für Befindlichkeitsstörungen, sowie säkular abgesunkene Religiosität; Globuli etc. sind die Äquivalente der Hostie auf der Zunge des Katholiken etc. Ob man diese Bedürfnisse aus den Etats der Krankenkassen bedienen muss, sei dahingestellt.

  120. #123 G.W.
    9. Mai 2012

    Nachtrag

    Gerade wenn man nicht, wie Herr Walach unterstellt, Wissenschaft als Religionsersatz, sondern eher pragmatisch sieht, ist man umso mehr bemüht, ihre Integrität zu erhalten. In Analogie: Man muss ja auch das Spielen einer Oboe nicht zur primären oder alleinigen Weltanschauung erheben. Wenn man aber Mitglied eines Sinfonieorchesters als Oboist sein möchte, muss man erstens Oboe spielen können und zweitens sich an die Regeln halten, sowohl diejenigen des Orchestermusizierens als auch an diejenigen des Oboespielens. Wenn man sich ohne ausreichende Technik bewirbt oder während des Spiels als Ausdruck künstlerischer Freiheit wiederholt Unfug anstellt, indem man etwa verkehrt herum in das Instrument bläst, gehört man nicht zum Orchester. Das hat nichts mit Inquisition, sondern mit Integrität und Funktionsfähigkeit zu tun. Und wenn man sich dann hinstellt und unter Abspielen einer historischen CD mit einem großen Solisten sich selbst als großen Oboisten feiern lassen will: bitte.

  121. #124 Ponder
    10. Mai 2012

    @ G.W. 09.05.12 · 20:31 Uhr :

    Danke für Ihre differenzierte Einschätzung!

    Im folgenden doc (S.342 im Original, S.26 im pdf) noch mal ein ausführlicher Artikel von Harald Walach, in dem er seine Sicht zu Qualitätssicherung in Forschung und Lehre darlegt:

    http://www.forschung-und-lehre.de/wordpress/Archiv/2009/05-2009.pdf

    Ich habe den Artikel bislang nur überflogen, aber er erscheint mir schon im Auftakt bezeichnend und aufschlussreich hinsichtlich der Grundhaltung, die Harald Walach auch jetzt in seinen Statements zu dieser völlig vermurksten Arbeit an den Tag legt. >:-(

  122. #125 Joseph Kuhn
    10. Mai 2012

    Die Süddeutsche Zeitung greift das Thema heute auf der Wissensseite auch noch einmal auf.

  123. #127 Ponder
    10. Mai 2012

    Diese Version ist auch schön – mit dem Portal der Alma Mater ;-)

    http://jetzt.sueddeutsche.de/texte/anzeigen/546538/Zu-tief-in-die-Roehre-geschaut

  124. #128 noch'n Flo
    10. Mai 2012

    @ G.W.:

    Hier in der Schweiz sind die Pseudowissenschafts-Vertreter sogar schon einen Schritt weiter: in den Kantonen Basel-Stadt und Basel-Land dürfen sich Heilpraktiker mittlerweile “Natur-Arzt” nennen. Dies suggeriert eine fundierte (akademische) Ausbildung, wo keine vorhanden ist. Die Bedingungen zur Ausübung dieses Berufes sind sogar noch lascher als in Deutschland: man muss lediglich 18 Jahre alt sein und einen sauberen Strafregisterauszug vorweisen können (also nicht einmal, wie in Deutschland, eine Prüfung über den erfolgten Erwerb eines zumindest rudimentären medizinischen Basiswissens ablegen).

  125. #129 klauszwingenberger
    10. Mai 2012

    @ noch’n Flo:

    Entgegen den Mythen war die Schweiz vor ein paar hundert Jahren das Afghanistan Europas

    Sagt Dieter Moor, der keiner mehr sein möchte: http://www.n-tv.de/leute/Schweizer-sind-Idioten-article6202656.html?google_editors_picks=true

    Geschichte wiederholt sich als Farce.

  126. #130 G.W.
    10. Mai 2012

    @noch’n Flo 18:19

    Die Sache hat, glaube ich, zwei Aspekte.

    Zum einen eine mögliche Interferenz mit der eigentlichen Wissenschaft. Die befürchte ich nicht. Jeder, der dort tätig ist, ist weit von den esoterischen Kindereien entfernt. Dass beispielsweise ein Carlo Rovelli, ein Martin Bojowald, ein Lee Smolin, ein Thomas Thiemann „Global Scaling“ und dergl. ernst nimmt und damit Zeit verschwendet, ist nicht anzunehmen. Ein Blick in deren Fachbücher würde Herr Walach belehren können, wie gigantisch weit die ernsthafte Forschung zur Raum-Zeit-Struktur von mit Alufolie ausgekleideten Dosen ist. Und Analoges gilt, so glaube ich, auch für die Medizin.

    Ein anderes ist die Bedeutung von „Wissenschaft“ in der Öffentlichkeit. Da scheint mir die böse Ironie darin zu liegen, dass diejenigen unter dem Publikum, welche die Aufweichung gut finden, vermutlich primär diejenigen sein werden, die die Zeche zahlen. Solange Wissenschaft hohen Standards folgt, kann sich auch ein Laie auf die Ergebnisse verlassen, die er ja in der Regel nicht zu überprüfen in der Lage ist. Sobald man beginnt, auch auf Pseudomaschinen zu setzen, deren Aktion sich der systematischen Überprüfung entzieht usw., gerät die Glaubwürdigkeit der gesamten Wissenschaft in Gefahr, sofern so etwas ebenfalls unter „Wissenschaft“ firmiert. Das ist natürlich durchaus im Sinne der Aufweicher.

    Völlig parallele Strategien werden im übrigen von Kreationisten u.ä. verfolgt, um sich ins Spiel zu bringen und die Gegenseite zu relativieren. Dem liegt eine Art „Äquilibrations-Dominanz-Strategie“ zugrunde. Zuerst zeigt man, dass alles sich letztlich auf vergleichbarer Ebene bewege, sodann, dass die eigene Vorstellungswelt weiter gespannt und daher dann doch überlegen sei; ein derartiges Bestreben liegt ja den „ganzheitlichen“ Ansätzen hier auch zugrunde.

    Im Ergebnis kann der Laie sich auf nichts mehr verlassen, denn natürlich wird die „alternative“, „erweiterte“, „kreative“ usw. Wissenschaft auch viele Irrtümer produzieren, die zu ignorieren man schon Fanatiker sein muss. Das alles läuft aber dann unter „Wissenschaft“, und zu entscheiden, ob etwas valide ist, erfordert jetzt vom Einzelnen, ins Detail zu gehen, wozu in der Regel die Kompetenz nicht reicht. Im Endeffekt ist das ein Schub in Richtung Irrationalisierung und Entmündigung, obwohl es gerade gegenteilig verkauft wird.

  127. #131 Taucher
    10. Mai 2012

    Um die Art der Argumentation von Dr. Walach und Dr. Schmidt besser zu verstehen sollte man sich an die Sokal Affäre erinnern.

    Beliebigkeit ist das Ziel und kein Betriebsunfall.

    Siehe http://de.wikipedia.org/wiki/Sokal-Aff%C3%A4re

    Fachartikel “Transgressing the Boundaries: Towards a Transformative Hermeneutics of Quantum Gravity”

    Sokals Buch dazu ist auch sehr lesenswert.

    Eleganter Unsinn. Wie die Denker der Postmoderne die Wissenschaften mißbrauchen

    Alan Sokal, Jean Bricmont, Dietmar Zimmer,

    ISBN-10: 3406452744

  128. #132 G.W.
    11. Mai 2012

    @Taucher 21:57

    Bei Sokal ging es m. E. eher um „Intellektuelle“, um „Geisteswissenschaften“ usw., vor allem um eine Mischung aus Geltungsbedürfnis und Streben nach Einsicht, und ebenfalls, doch nicht so sehr wie im gegenwärtigen Fall, um Fleischtöpfe.

    Dass eine Hellseharbeit unter Medizin firmiert oder dahin strebt, gibt ja zu denken. Heißt das, dass die Krankheit dem Patienten namentlich einbeschrieben (allerdings nicht bewusst) ist und nur per aluminiumbeschichteter Dose ausgelesen werden muss? Heißt das, dass man auch den umgekehrten Weg beschreiten kann und die Therapie per Namensmagie in den Patienten einlesen kann? Der Nürnberger Trichter in der Medizin?

    Das alles ist umso trauriger, als man sich ja sehr wohl auf hohem Niveau über Kohärenz, Verschränkung, Dekohärenz usw. Gedanken machen kann, anknüpfend an Nichtlokalität, die Kontextabhängigkeit von Observablen usw. Da bewegt sich ja auch etwas in der Forschung, sowohl der experimentellen als auch der theoretischen. Nur halt nicht auf Phantastenlevel.

  129. #133 ZetaOri
    11. Mai 2012

    @G.W.· 11.05.12 · 18:32 Uhr

    [...] und nur per aluminiumbeschichteter Dose ausgelesen werden muss? Heißt das, dass man auch den umgekehrten Weg beschreiten kann und die Therapie per Namensmagie in den Patienten einlesen kann? Der Nürnberger Trichter in der Medizin?[...]

    Na klar! Und wenn Du `ne ganz starke Reliquie in die Dose legst, z.B. `nen Finger oder Zeh vom ollen Hahnemann, oder auch nur einen Schnipsel von seinem heiligen original Potenzier-Lederkissen, steht der Unsterblichkeit eigentlich nichts mehr im Weg.
    Derzeit laufen nur noch Studien, ob die DVD-Spender von Verbatim oder die von maxell effektiver in der Anwendung sind. Bei den billigen von Aldi ist es schon vorgekommen dass da plötzlich die Reliquie verschwunden war und erst nach langer Suche mittels CT im Kopf des Therapeuten wiedergefunden (zum Glück, sooo viele Finger und Zehen hatte Samuel ja nun nicht) wurde, in dem es sich kollisionsfrei (ausreichend leerer Raum war vorhanden) materialisiert hatte.
    >;o)

  130. #134 Joseph Kuhn
    11. Mai 2012

    Ich bin gerade in Erfurt auf dem diesjährigen wissenschaftlichen Kongress des öffentlichen Gesundheitsdienstes. Der öffentliche Gesundheitsdienst in Deutschland ist in einer schwierigen Situation, er ist nach jahrelangem Personalabbau inzwischen in seiner Handlungsfähigkeit ernsthaft gefährdet. Da wird es, wenn SARS oder EHEC umgehen, mittlerweilen auch so manchem Staatsabbau-Fanatiker etwas mulmig. Eine positive Entwicklung ist dagegen die Stärkung des wissenschaftlichen Potentials im öffentlichen Gesundheitsdienst, hier hat sich in den letzten Jahren viel getan, z.B. was Untersuchungsmethoden oder die Epidemiologie angeht. Umso mehr hat mich verwundert, dass bei der Industrieausstellung des Kongresses auch ein Anbieter eines „Biopulsar-Reflexographs“ vertreten ist. Damit kann, so wird geworben, eine „bioenergetische Analyse“ vorgenommen werden. Über Reflexzonen auf der Hand könne man die Meridiane, die Aura und die Chakras einer Person untersuchen und so die Gesundheit einzelner Organsysteme darstellen, z.B. des Zwölffingerdarms oder des Kopfes. Bleibt zu hoffen, dass der öffentliche Gesundheitsdienst nicht aus Verzeiflung über seine Situation Zuflucht bei esoterischen Arbeitsweisen sucht – damit wird man gegen den nächsten EHEC-Ausbruch wohl wenig ausrichten.

  131. #135 G.W.
    11. Mai 2012

    @Joseph Kuhn 19:52

    Wenn es denn billiger ist als beispielsweise ein Ganzkörper-MRI und noch deutlich mehr Information liefert, warum nicht? Man fragt sich natürlich, ob die Vertreiber als Eichpersonen für die Gesundheit des Kopfes fungieren.

  132. #136 Ponder
    11. Mai 2012

    @ Joseph Kuhn:

    Gibt es auf der Industrieausstellung auch dieses sinnige Diagnostiksystem?

    http://www.metavital.eu/NLS_-_Oberon/nls_-_oberon.html

    http://www.metavital.eu/Artikel_Conrad.pdf

    @ G.W.:

    Heißt das, dass man auch den umgekehrten Weg beschreiten kann und die Therapie per Namensmagie in den Patienten einlesen kann? Der Nürnberger Trichter in der Medizin?

    Ja, offensichtlich heißt es das… :

    …Die Radionik ist ein modernes Diagnose- und Therapieverfahren, bei dem, so die Entwickler von entsprechenden Geräten, das Energiefeld eines Patienten „gelesen“ und durch Übertragung passender virtueller Schwingungsmuster
    eine Besserung der Krankheitssymptome erreicht werden soll…

    …Nach Aussagen der Hersteller sind die Schwingungsmuster der verwendeten Medikamente in den Datenbanken nicht in bekannten beschreibenden
    Dateiformaten gespeichert, sondern rein virtuell, d. h. nur als Foto oder eindeutig
    adressierbarer Name des Präparates.

    Die Auswahl der verwendeten Medikamentenfrequenzen und die homöopathische Potenzierung erfolgt manuell oder über die Diode mit dem weißen Rauschen individuell und gezielt in Resonanz, z. B. mit den Frequenzmustern des eingespeicherten Fotos des Patienten.
    Außerdem soll er nach demselben Funktionsprinzip die Daten und Frequenzmuster
    auf die Diode mit dem weißen Rauschen übertragen, welche wiederum das Frequenz-
    und Informationsmustergemisch auf ein Fläschchen mit Alkohol-Wassermischung überträgt oder gezielt ins universale Informations- und Quantenfeld „sendet“.

    Bislang gibt es für die radionische Therapie keinen physikalisch-wissenschaftlichen Wirksamkeitsnachweis.
    Erklärungsmodelle finden sich jedoch im Bereich der Quantenphysik und
    Quantenphilosophie.
    http://www.my-quantec.cl/de/pdf/025_dt_Heuschnupfen.pdf

  133. #137 G.W.
    12. Mai 2012

    @Ponder 22:32

    Danke für die Quellenangabe. Dort heißt es:

    „Wie aus dem Ergebnis der anonymen Patientenbefragung ersichtlich ist, hat sich die radionische Therapie in Kombination mit naturheilkundlichen Medikamenten in der Behandlung der Pollinose bewährt.“

    und wenig später:

    „Zu welchem Anteil jedes der verordneten Medikamente und Methoden nun genau am Erfolg der Therapie teilhatte, kann mit dieser Studie nicht beantwortet werden. Ebenso kann keine Aussage über einen längerfristigen oder anhaltenden Erfolg gemacht werden. Die vorliegenden Ergebnisse dieser Praxisstudie geben jedoch Anlass, weitere Folgestudien
    anzustreben.“

    Es kann also auch sein, dass die radionische Methode keinen wesentlichen Anteil hatte. Eine Placebokontrolle fehlt selbstverständlich.

    Zur radionischen Methode:

    „Dazu kamen, je nach aktueller Pollenflugphase, die virtuellen Therapiefrequenzen der jeweiligen Pollen.“

    Man fragt sich auch, ob irgendwelche immunologischen Daten vorliegen. Bemerkenswert ist im Zusammenhang der Kostendiskussion:

    „Nicht zu unterschätzen ist auch die Tatsache, dass durch die radionisch-naturheilkundliche Therapie den Krankenkassen viel Geld für teure Pharmaka erspart wird, da die radionischen Tropfen selbst hergestellt werden und die günstigen naturheilkundlichen Medikamente nicht dauerhaft verschrieben werden müssen.“

    Das lässt alle Träume wahr werden, die von Albträumen nicht unterscheidbar sind. Leider gibt es keinen Hinweis darauf, dass es sich um eine Satire seitens übelwollender Schulmediziner handelt.

  134. #138 Ponder
    12. Mai 2012

    @ G.W.:

    Leider gibt es keinen Hinweis darauf, dass es sich um eine Satire seitens übelwollender Schulmediziner handelt.

    Nein, darauf gibt es leider keinen Hinweis.
    Allerdings gibt es einen anderen bemerkenswerten Hinweis:

    Wir entschlossen uns zunächst zu einer einfachen, retrospektiven Dokumentationsstudie zur Pollinosetherapie im Rahmen einer Masterarbeit für den Studiengang „Komplementärmedizin- Kulturwissenschaften-Heilkunde“ an der Universität Viadrina in Frankfurt (Oder).

  135. #139 Joseph Kuhn
    13. Mai 2012

    @ Ponder:

    “Gibt es auf der Industrieausstellung auch dieses sinnige Diagnostiksystem? …”

    Mehr wie den “Biopulsar-Reflexograph” gab es gottseidank nicht. Im Prospekt der Firma kann man nachlesen, dass das Gerät u.a. mit einer grünen “Harmonielinie für die Anzeige der Abweichung einer Organzone vom harmonischen Energiezustand” funktioniert. Wie schön wäre es, wenn es für ganze Organsysteme wirklich so klare Normen gäbe, anhand derer man krankhafte Veränderungen feststellen könnte. Da kommt doch ein ziemlich schlichtes und letztlich ingenieurswissenschaftliches Bild des Menschen zum Vorschein. Die Anzeige einer Kurve über oder unter einer Normlinie auf einem Bildschirm ist eben sehr eindrucksvoll. Dafür werden als Ausgleich Meridiane und Chakren postuliert, weil der Mensch ja komplizierter ist, als die westliche “Schulmedizin” denkt. Das Gerät liefert dazu die “dynamische Präsentation der Aura um den ganzen Körper für die Auswertung der psychoenergetischen Konstitution einer Person”. Das wird alles ganz wissenschaftlich gemacht: “alle 500 Millisekunden erfolgt eine Hautwiderstandsmessung”, u.a. für eine “dynamische Chakra-Darstellung mit mathematischer Auswertung”. Ich will hier gar nicht über Meridiane oder Chakren in ihrem fernöstlichen kulturellen und historischen Kontext urteilen, aber dort herausgelöst und implantiert in technische Messsysteme, für die ganz selbstverständlich unsere Naturwissenschaft als gültig angenommen wird, ist das reichlich abstrus, sozusagen die Elektrifizierung fernöstlicher Medizintheorien.

    Als Einsatzgebiete des Geräts werden u.a. ganzheitliche Zahnarztpraxen, Ernährungsinstitute, psychotherapeutische Praxen, Institute für Geistheilung und natürlich “Forschung und Wissenschaft” genannt. Als nächste technische Entwicklungsstufe könnte man die Verknüpfung mit dem Kozyrev-Spiegel empfehlen, eine Masterarbeit in Frankfurt/O. wird sich dazu schon finden. Das Gerät wird übrigens von der Auramed GmbH (www.auramed.de) hergestellt und ist nach CE 0483 und ISO 13485 zertifiziertes Medizinprodukt. Ob bei der Zertifizierung auch schon der Kozyrev-Spiegel zum Einsatz kam, ist nicht bekannt.

  136. #140 Daniel Elstner
    13. Mai 2012

    Da kommt doch ein ziemlich schlichtes und letztlich ingenieurswissenschaftliches Bild des Menschen zum Vorschein.

    Unterschätzen Sie mal die Ingenieurswissenschaften nicht. :) Man kann auch bei z.B. Computerprozessoren nicht an Hand einer einzigen Größe (sagen wir z.B. Temperatur) auf den “Gesundsheitszustand” der Baugruppe schließen.

    Ganz unrecht haben Sie mit Ihrer Beobachtung allerdings nicht, aber ich würde es eher so formulieren: Die Esoterikfraktion scheint mir wesentlich eher “materialistisch” zu denken (in der Klischeebedeutung von “materialistisch”), als dies die tatsächlichen Materialisten selbst tun. Abstrakte Konzepte wie Frequenzen, Information oder auch Geist werden sprachlich in einer Weise verwurstet, als ob es sich um im materiellen Sinne greifbare Dinge handeln würde.

    Die zunehmende Technisierung der Esoterik ist in der Tat ein auffälliger Trend. Ich vermute dahinter trotz aller anti-naturwissenschaftlichen Rhetorik eine gewisse ängstliche Faszination mit den Erzeugnissen moderner Technik. Aus Sicht von Esoterikanhängern fühlen sich heutige technische Geräte wahrscheinlich wie geheimnisvolle okkulte Gegenstände an — sie verstehen ja meist nicht deren Funktionsweise und finden daher keinen angemessenen emotionalen Bezug dazu.

    Aus rationaler Sicht ist es natürlich absurd, in eine “esoterische Signalkette” einen digitalen Computer einzubauen. Digitale Computer sind eigentlich so etwas wie perfekte Esoterikfilter — sie können schon vom Konzept her prinzipiell nichts Unbekanntes verarbeiten. Die Zahl der darstellbaren Zustände ist endlich, alle Abläufe perfekt deterministisch — es sei denn, der Computer ist defekt. Zwischen 1 und 0 passt keine unentdeckte Physik rein.

    Dass es trotzdem nicht möglich ist, derartige logische Unmöglichkeiten routiniert vor Gericht als Betrug zu bewerten, erstaunt mich immer wieder.

  137. #141 Dr. Webbaer
    13. Mai 2012

    Digitale Computer sind eigentlich so etwas wie perfekte Esoterikfilter — sie können schon vom Konzept her prinzipiell nichts Unbekanntes verarbeiten.

    Keineswegs, die Informationstechnologie lädt zur Modellierung von Anthropogen-Theoretischem ein, schafft Modelle, also Abbilder, die als Simulationen allgemein als real wahrgenommen werden können, kann eine Gegenrealität schaffen und im Bereich der Prognostik für die Esoterik (vs. empirische Wissenschaft) das Einfallstor schlechthin werden.

    Nur ganz am Rande angemerkt,
    MFG
    Dr. Webbaer

  138. #142 Daniel Elstner
    13. Mai 2012

    @Dr. Webbaer:

    Die Anwendung von Computern zur Simulation von Welten, in denen andere Regeln herrschen, ist aber nicht das, was ich mit meinem Beitrag meinte. Zudem dort auch von Anfang an klar ist, dass es sich um Simulationen (also nicht die Realität) handelt. Darüber hinaus ist man auch gezwungen, alles was simuliert werden soll vollständig zu beschreiben. Auf dieses so beschriebene Modell könnte man Esoteriker dann im Vergleich mit der Realität leicht festnageln — es würde kein Platz bestehen für die üblichen ad-hoc Ausflüchte.

    Ich bezog mich aber ohnehin eher auf Ideen wie z.B. die Übertragung “homöopathischer Heilinformation” per Internet. Und dafür müsste man diese “Heilinformation” eben auslesen und vollständig beschreiben können — allein schon die Sensorik am Eingang setzt die Messung bekannter Größen voraus, und die anschließende Digitalisierung verunmöglicht, dass Unbekanntes dabei sozusagen huckepack genommen werden kann.

  139. #143 Dr. Webbaer
    13. Mai 2012

    @Daniel
    Schon klar, es handelt sich um einen Randaspekt im Kontext dieses Artikels, aber um einen ansonsten gesellschaftlich außerordentlich wichtigen Aspekt, der der Esoterik ebenfalls den Weg bereiten kann – denn die Leutz glauben an Simulationen, so wie Sie anscheinend: ‘Darüber hinaus ist man auch gezwungen, alles was simuliert werden soll vollständig zu beschreiben.’ – Richtig dagegen, dass Simulationen basierend auf einer nur ausschnittsartig (vs. ‘vollständig’) erfassten Datenlage und auf einer groben und letztlich willkürlichen Theoretisierung politisch stark wirken.

    Das ist überhaupt etwas, was diesem Schreiber hier ein wenig fehlt: der “wirkliche” Skeptizismus, die Homöopathie und Vergleichbares weggähnen kann jeder

    MFG
    Dr. Webbaer

  140. #144 Daniel Elstner
    13. Mai 2012

    Richtig dagegen, dass Simulationen basierend auf einer nur ausschnittsartig (vs. ‘vollständig’) erfassten Datenlage und auf einer groben und letztlich willkürlichen Theoretisierung politisch stark wirken.

    Ich befürchte ich weiß, wohin der Wind weht, aber die Klimadiskussion sollten wir hier besser lassen. Ansonsten bleibe ich bei meiner Aussage, dass alles was simuliert werden soll vollständig beschrieben werden muss. Das heißt nicht automatisch, dass das simulierte automatisch ein perfektes Modell der Realität wäre (dann wäre es ja auch kein Modell mehr). Im Übrigen sind alle unsere naturwissenschaftlichen Erkenntnisse gewissermaßen mehr oder weniger gute Modelle der Realität, das ist keinesfalls auf Computersimulationen beschränkt.

  141. #145 Dr. Webbaer
    13. Mai 2012

    Ansonsten bleibe ich bei meiner Aussage, dass alles was simuliert werden soll vollständig beschrieben werden muss. Das heißt nicht automatisch, dass das simulierte automatisch ein perfektes Modell der Realität wäre (dann wäre es ja auch kein Modell mehr).

    Was simuliert werden soll, ist die Realität. Diese ist nicht vollständig beschreibbar, d.h. es wird für’s Modellwesen immer genähert und hypothetisiert. – BTW: Es gibt auch Modelle für das Mathematische, Stochastische Prozesse beispielsweise, diese sind für ihren Anwendungsbereich perfektes Modelle.

    MFG
    Dr. Webbaer (der sich natürlich primär auf Wirtschaftssimulationen bezog)

  142. #146 Daniel Elstner
    13. Mai 2012

    Was simuliert werden soll, ist die Realität.

    Aus der Sicht dessen, der die Computerumsetzung vornimmt, ist das was simuliert werden soll das zuvor festgelegte Modell der Realität. In diesem Sinne sind meine Ausführungen zu verstehen.

    Ansonsten sind wir jetzt wirklich weit off-topic.

  143. #147 Dr. Webbaer
    13. Mai 2012

    @Daniel

    Ansonsten sind wir jetzt wirklich weit off-topic.

    Nicht, wenn Sie so etwas behaupten: ‘Digitale Computer sind eigentlich so etwas wie perfekte Esoterikfilter (…)’

    Denn wenn Sie recht hätten, käme die Esoterik (inklusive Kozyrev oder Herr Walach) womöglich bald mit eigenen Esoterik-Rechnern.

    Das Wesen der Esoterik verdient möglichst präzise Betrachtung.

  144. #148 Daniel Elstner
    13. Mai 2012

    Denn wenn Sie recht hätten, käme die Esoterik (inklusive Kozyrev oder Herr Walach) womöglich bald mit eigenen Esoterik-Rechnern.

    Nur wenn sie an der Auflösung logischer Widersprüche tatsächlich interessiert wären. Walach beispielsweise verlegt sich ja auf die reine Empirie; etwaige logische Widersprüche in der Umsetzung würde er vermutlich gar nicht erst diskutieren wollen.

  145. #149 Dr. Webbaer
    13. Mai 2012

    Walach ist interessant und im Vortrag beklemmend, auch wegen seines Charmes, kA, was noch alles möglich sein wird, wenn “Beijing” so zur Umsetzung gelangt.

    Schauen Sie gerne mal bei Walach, also in seine Texte und “Apologetik”, rein, vielleicht fällt Ihnen mehr dazu ein als diesem Kommentator.

  146. #150 G.W.
    13. Mai 2012

    Dass Esoterik und Homöopathie oft auf einen verblüffend simplen Materialismus hinauslaufen, ist eine, wie ich glaube, sehr treffende Beobachtung. Dieser Materialismus ist aber „spirituell“ aufgeladen, wie im Kult von Reliquien usw.

    Die Diskussion um Modelle scheint mir wenig sinnvoll. Die gesamte Naturwissenschaft unternimmt nichts anderes als Modelle für mehr oder weniger umgrenzte Fragenbereiche zu erstellen, und die sind immer Idealisierungen, gleich ob deterministisch oder stochastisch.

    Auch ist ein Computer m.E. nicht mehr und nicht weniger ein Esoterikfilter als eine beliebige physische Intervention am Patienten. Zwar arbeitet er intern mit Reduktion auf binäre Zustände usw., das schließt aber im Prinzip nicht aus, dass darauf aufsitzend „per Verschränkung“ andere Information transportiert wird bzw. genauer gesagt nichtlokale Zusammenhänge sich manifestieren. Wenn etwa in einem Experiment Photonen mit entgegengesetzter Polarisierung per Glasfaserkabel transportiert werden, kann man ja auch ihren geheimnisvollen Zusammenhang in einem durch und durch technisierten System nachweisen. Die Entwicklung von Quantencomputern soll so etwas ja nutzen, so dass auch der Einwand, man könne so keine Information übertragen, nicht unbedingt verfängt.

    „Verschränkung“ ist eben das moderne Zauberwort. Es ist ein Glücksfund für die Esoterik, 1. von den Quanten und 2. von der Verschränkung gehört zu haben. Das eröffnet der pseudowissenschaftlichen Diktion buchstäblich alle Möglichkeiten.

    Die Arbeit über die radionische, quantengegründete Therapie des Heuschnupfens finde ich eigentlich noch abstruser als die über das Hellsehen. Letztere bemühte sich ja wenigstens um eine Art Methode, erstere aber nicht einmal um das. Die saisonale allergische Rhinitis beruht auf einem ziemlich gut verstandenen, IgE-vermittelten immunologischen Geschehen. Es gibt dafür effektive und kostengünstige Medikamente, die auch nur in der jeweiligen Pollenflugzeit benötigt werden.

    Wie bestimmt man die virtuellen Frequenzen von Pollen? Anhand von molekular charakterisierten Epitopen, Photos, ihren deutschen oder lateinischen Namen? Haben verwandte Arten auch verwandte Frequenzen? Neutralisiert die radionische Therapie die Epitope oder das spezifische IgE oder verhindert sie nur die anschließende zelluläre Antwort von Mastzellen, Basophilen usw.? Könnte man nicht so auch Kinder vor der Entwicklung einer Allergie schützen, indem man ihnen rechtzeitig Tropfen mit den virtuellen Frequenzen aller möglichen Pollen gibt? Wäre das nicht etwa derzeit wegen Artemisia anzuraten?

    Kann man nicht umgekehrt durch falsch gewählte Frequenzen auch eine Sensibilisierung erreichen oder begünstigen? Oder geht das nur in eine Richtung? Kann man nicht gar – analog dem Schadenszauber – radionisch eine Krankheit in einen Menschen einlesen statt einer Therapie? Erklären sich Volkskrankheiten über unfreiwillige radionische Dystherapie somit aufgrund multifrequenter elektromagnetischer Strahlung, allgegenwärtiger Leuchtdioden usw.? Fragen über Fragen.

    Ich hoffe, die für die Arbeit als verantwortlich zeichnende Ärztin hat nicht auch noch die Zusatzbezeichnung „Allergologie“ erworben.

  147. #151 Dr. Webbaer
    13. Mai 2012

    Die Diskussion um Modelle scheint mir wenig sinnvoll.

    Das rechnergestützte Modellieren und Simulieren ermöglicht es dem wissenschaftlich (oder: “wissenschaftlich”) Bemühten eine Distanz zu schaffen und vom Rechner ausgegebene Szenarien als objektiv zu vermarkten. – Man muss froh sein, dass sich die Esoterik hier bisher noch zurückgehalten hat (von anderen von diesem Kommentatoren als in Teilen esoterisch eingestuften Bemühen einmal abgesehen)!

    Die Verschränkung und andere “Spuk-Effekte” geben esoterisch nichts [1] her, es sei denn man will auf der Basis des Missverstehens vermarkten.

    MFG
    Dr. Webbaer

    [1] natürlich nicht ganz richtig, die theoretische Physik selbst ist hier gefordert

  148. #152 G.W.
    13. Mai 2012

    @Dr. Webbaer 16:50

    Es geht im Modellieren, gleich ob rechnergestützt oder nicht, m.E. nicht primär um „Distanz“, sondern eher instrumentalistisch um konzeptionelle, formale und praktische Handhabbarkeit (keineswegs allein um praktische). Die Realismus-Instrumentalismus-Diskussion usw. der Physik bringt allerdings m.E. für den konkreten Fall, um den es hier geht, nichts. Diese Diskussion spielt sich auf einem Niveau ab, das Esoterikern unzugänglich sein dürfte (siehe z.B. den Sammelband „Philosophie der Physik“, herausgegeben von Michael Esfeld, Suhrkamp 2012).

    Die Schaffung eines wunschgemäßen weltanschaulichen Hintergrundes ist essenziell für Esoterik, da sie ja an „objektiven“ Prüfungen regelhaft scheitert und also auf Wohlwollen angewiesen ist. Dies zu erzielen oder bedienen ist die Basis der Vermarktung in der modernen Gesellschaft, und die umfasst den Rekurs auf uralte Weisheiten ebenso wie auf die modernste Physik. Das Buch von Capra seinerzeit schlug ja lange Zeit viele Wellen.

    Dass im generalisierten Quantengerede wirklich interessante Fragen auf der Strecke bleiben, habe ich im letzten Absatzes meines Kommentars vom 11.5., 18:32, angedeutet. So gibt es ja unter Physikern verschiedene Meinungen zur den makroskopischen Konsequenzen quantenmechanischer Kohärenz und der damit verbundenen Nichtlokalität, auch wenn offenbar die überwiegen, welche die makroskopische Zerstörung von Kohärenz für absolut dominant halten.

  149. #153 Daniel Elstner
    13. Mai 2012

    Wenn etwa in einem Experiment Photonen mit entgegengesetzter Polarisierung per Glasfaserkabel transportiert werden, kann man ja auch ihren geheimnisvollen Zusammenhang in einem durch und durch technisierten System nachweisen. Die Entwicklung von Quantencomputern soll so etwas ja nutzen, so dass auch der Einwand, man könne so keine Information übertragen, nicht unbedingt verfängt.

    Ja, aber Computersoftware arbeitet mit abstrakter Information und nicht mit konkreten Photonen. Der Filter entsteht durch die Abstrahierung, und dem Weiterverarbeiten auf rein symbolischer Ebene. Die zu Grunde liegende Hardware ist im Prinzip austauschbar — gäbe es auch eine Quantenverschränkung bei rein mechanischen Computern?

    Gäbe es Verschränkungseffekte, die von Transistor zu Transistor bis zum Ende durchgereicht werden, müsste der Effekt abhängig von der Bauart der Computer sein. Ein Quantencomputer kommt aber nicht zu anderen Ergebnissen als ein klassischer, er arbeitet nur auf andere Weise.

  150. #154 G.W.
    13. Mai 2012

    @Daniel Elstner 17:39

    Natürlich haben Sie aus konventioneller Sicht recht, aber um diese ging es mir nicht.

    Verschränkungseffekte würden nicht von Transistor zu Transistor weitergereicht, sondern wären nichtlokal buchstäblich überall präsent. Denn eigentlich gibt es bei konsequenter Anwendung der Quantenmechanik ja nur eine „Wellenfunktion“, die das gesamte Universum beschreibt. Das kann man jetzt esoterisch ins rein Verbale ausweiten und so buchstäblich alles erklären. Ihre Kritik an den unplausiblen oder absurden Konsequenzen in concreto ist da völlig berechtigt.

    Worum es mir ging, ist ein viel grundlegenderes Problem, nämlich ob nicht doch klassische Residualeffekte der Kohärenz bestehen und messbar sind. Es gibt keine zu 100 % abgeschlossenen (Quanten-)Systeme, das war historisch eine Idealisierung. Nach gängiger Auffassung in der Theorie offener Quantensysteme sind System und Umgebung regelhaft miteinander verschränkt. Allerdings führt die enorme Zahl (im Effekt orthogonaler) Freiheitsgrade in der Umgebung, vereinfacht gesprochen, dazu, dass die Superposition in sehr kurzer Zeit durch Dekohärenz (z.B. Schlosshauer 2008, Breuer & Petruccione 2010) in ein klassisches Gemisch überführt wird und in der Konsequenz auch auf Systemebene ein definierter Zustand erzwungen wird. Daraus schließt man, dass lokale Beobachter nur klassische Zustände einnehmen können. Dieser Schluss ist aber nicht zwingend, zumal im gleichen Formalismus auch der Begriff des lokalen Beobachters unangemessen erscheint. Ferner ist es denkbar, dass die Wahrscheinlichkeit eines finalen klassischen Zustandes von „fernen“ Superpositionen abhängt. Dies umso mehr, als die Information ja nicht verloren geht, sondern nur (in unserer Sicht) unzugänglich wird. Da ist also durchaus vieles offen, an das man anknüpfen könnte (siehe z.B. den Beitrag von Michael Esfeld selbst and anderen in dem von mir erwähnten Sammelband). Und man konstruiert ja auch makroskopische Superpositionen in immer größerem Maßstab. Nur haben die Esoteriker eben kein vorsichtiges Erkenntnisinteresse, sondern primär ein schlichtes Erklärungs- und Verkaufsinteresse.

  151. #155 Joseph Kuhn
    14. Mai 2012

    Medieninteresse hat die seltsame Masterarbeit durchaus gefunden. Heute hat auch noch ein Journalist nachgefragt, der für SCIENCE arbeitet. Was nach wie vor fehlt, ist ein öffentliches Wort der Universitätsleitung. Vielleicht spricht man ja intern mit dem Institut, ein Ruhmesblatt ist das Schweigen der Viadrina jedenfalls nicht.

  152. #156 Stefan W.
    15. Mai 2012

    Was nach wie vor fehlt, ist ein öffentliches Wort der Universitätsleitung.

    Noch will sich die Uni wohl vorsichtig neu positionieren, neue Märkte erobern. Das Klientel erweitern.

    Gleichzeitig will man das Stammpublikum nicht verschrecken. Also duckt man sich ab.

    Christen die Theologie studieren akzeptiert man ja auch allenthalben – also wieso nicht Rutengeher?

  153. #157 ZetaOri
    15. Mai 2012

    @Stefan W.· 15.05.12 · 04:25 Uhr

    [...] Noch will sich die Uni wohl vorsichtig neu positionieren, neue Märkte erobern. [...]

    Schon dass man Begriffe wie Universität und Markt gedanklich in Verbindung bringen kann zeigt eine verhängnisvolle Tendenz im akademischen Betrieb auf. Wenn die Freiheit von Forschung und Lehre, ein Recht mit Verfassungsrang (Art. 5 Abs. 3 GG), dazu missbraucht wird, eine “Nachtwächter-Universität” zu konstituieren, dann wirklich: “Gute Nacht, Wissenschaft!”

    Christen die Theologie studieren akzeptiert man ja auch allenthalben – also wieso nicht Rutengeher?

    Leider werden wir erstere wohl nicht so schnell loswerden, was aber kein Grund ist, letzteren nun auch Raum zu geben. Und zumindest versuchen die “christlichen Theos” nicht (wäre mir zumindest nicht bekannt, und die dürfen ja auch angeblich nicht lügen ;o)) die Transsubstantiation mit Quanteneffekten zu begründen.
    Sollten die anfangen, mittels bifilarer Spulen aus ihren Messkelchen den Gesundheitszustand ihrer Gemeindemitglieder zu diagnostizieren (und das zum Lehrinhalt universitärer Theologie zu machen), dürfte es mit der Akzeptanz auch in der Öffentlichkeit schnell vorbei sein.
    >;->

  154. #158 Joseph Kuhn
    15. Mai 2012

    @ Stefan W.: Die Theologie kann für sich immerhin in Anspruch nehmen, an der Wiege des europäischen Universitätswesens zu stehen. Esoterik an den Hochschulen hat keine derartige Geschichte, sie ist eher so etwas wie die pathologisch geformte, nicht verstandene Wiederkehr des Verdrängten im neuzeitlichen Rationalismus, um es einmal mit einer psychoanalytischen Metapher zu formulieren.

    Hochschulpolitisch haben Sie mit den neuen Märkten wohl recht, hinzu kommt, dass das Land Brandenburg keine medizinische Fakultät hat und man daher vielleicht wenigstens ein gesundheitswissenschaftliches Institut beherbergen will, zumal, wenn man die Professur als Stiftungsprofessur spendiert bekommt. An die Zunahme von Stiftungsprofessuren mit ihren zwangsläufigen Rücksichtnahmen auf die Stifterinteressen kann man allerdings durchaus wieder ähnliche Fragen stellen wie an den institutionalisierten Einfluss der Kirchen auf das staatliche Hochschulwesen, vor allem, was den Einfluss der Kirchen auf nichttheologische Lehrstühle angeht.

  155. #159 Joseph Kuhn
    15. Mai 2012

    Die Viadrina hat es geschafft, bei ihrem Wikipedia-Eintrag als Esoterik-Universität geführt zu werden:

    “Die Europa-Universität Viadrina in Frankfurt (Oder) ist die östlichste Universität Deutschlands. Sie bietet Studien in Kulturwissenschaften, Jura und Wirtschaftswissenschaften sowie ein Masterstudium zu Themen der Alternativmedizin und Esoterik an.”

    Sehr schön auch die Feststellung zum Institut für transkulturelle Gesundheitswissenschaften: “Bekanntheit erlangte das Institut unter anderem durch eine Masterarbeit, die sich affirmativ mit dem Kozyrew-Spiegel, durch den Hellseherei oder Kontakte zu Außerirdischen und Verstorbenen möglich sein sollen, befasst.”

    Herzlichen Glückwunsch, Viadrina! “Borders in motion” heißt es auf der Startseite der Bewerbung zur Exzellenzinitiative auf der Internetseite der Viadrina. Die Grenzen der Wissenschaftlichkeit sind hier allemal in Bewegung.

  156. #160 Ponder
    16. Mai 2012

    @ Joseph Kuhn:

    Beim Lesen des Wikiartikels stolperte ich zunächst über den Satz

    Unter Lehrkräften und Mitarbeitern der Viadrina ist das Berufspendeln sogar noch verbreiteter.[5]

    :D :D :D

  157. #161 Ponder
    16. Mai 2012

    @ all:

    Jetzt gibt es schon Versuche eines IntraG- Offiziellen (Andreas Giesen), auf den Wikipedia-Artikel Einfluss zu nehmen – Diskussionsverlauf hier:

    http://de.wikipedia.org/wiki/Diskussion:Europa-Universit%C3%A4t_Viadrina

  158. #162 Ponder
    16. Mai 2012

    Oh, es gibt schon die Vorbereitung eines Maulkorbs gegen die FAZ:

    http://intrag.info/Unterlassung_FAZ/

  159. #163 G.W.
    16. Mai 2012

    @Ponder 14:06

    Es ist ein Nebenkriegsschauplatz, den Herr Walach aufmacht, verglichen mit dem Gesamtproblem. Der Kalkül dürfte allerdings darin liegen, hier zu gewinnen (was möglich erscheint), um dann die gesamten Anwürfe als abgeschlagen darzustellen.

    Vernünftig wäre es m.E., die Sache auf sich beruhen und abebben zu lassen, jedoch für die Zukunft effektive Konsequenzen zu ziehen. Auch solche Arbeiten wie die über die radionische Therapie des Heuschnupfens sind dilettantisch und dürfen nicht wieder unter dem Siegel von „Wissenschaft“ vorkommen; bei näherer Suche dürfte sich allerdings etliches dieser Art finden. Die Art und Weise, die Ehre per Kanzlei retten zu wollen, erscheint kläglich. So hat die verallgemeinerte Quantentheorie beispielsweise in meinen Augen nicht mehr fassbare wissenschaftliche Substanz als die Konstrukte von Global Scaling und dergleichen. Es sind im besten Fall ausschweifende Spekulationen (nur eben auf niedrigem Niveau und nicht dem von Kosmologen und Wissenschaftstheoretikern), im schlechtesten reine Phantasieprodukte. Allerdings sind die keineswegs so kreativ wie sie vorgeben, denn es läuft ja auf das Immergleiche hinaus: Hellsehen, Geistheilen usw.

    Man muss zwar nicht befürchten, dass die wirkliche medizinische und naturwissenschaftliche Forschung durch solche Vorgänge affiziert wird (zumal die Viadrina hier nichts zu melden hat), wohl aber, dass universitäre Abschlüsse und Qualifikationen insgesamt weiter entwertet werden. Was ist ein M.A. noch wert, wenn dieser Schrott durchgeht? Der Prozess der Entwertung läuft allerdings bereits seit langem und wird durch die kurrente Marktanbetung weiter angetrieben. Es ist immer das gleiche Spiel: Nimbus und Markenzeichen teuer verkaufen, aber die Qualitätskriterien unterlaufen. Das ganze firmiert dann unter Freiheit der Forschung. Den neuen Kopernikus, Galilei, Einstein, Weyl, Wigner, Feynman, Witten, der von der Viadrina kommt, möchte ich gerne sehen.

  160. #164 zwingenberger
    16. Mai 2012

    @ Ponder:
    Es wäre ganz nett zu erfahren, welchen Unterlassunsverlangen die FAZ nicht nachgekommen ist. Offensichtlich war doch noch mehr beansprucht, das kann man dem letzten Satz im Schreiben der FAZ entnehmen.

  161. #165 Joseph Kuhn
    16. Mai 2012

    @ Ponder: Danke für die Links. Der Hinweis auf die Esoterik im ersten oben zitierten Satz aus Wikipedia ist dort auch schon wieder verschwunden. Das ging schnell. Falsch war es eigentlich nicht, denn die hier diskutierte Masterarbeit ist ja Teil des Studiums.

  162. #166 Ponder
    16. Mai 2012

    Neues von Harald Walach:

    http://intrag.info/aktuell/2012/05/16/so-einfach-ist-wissenschaft-nicht-masterarbeit-ist-qualifikationsarbeit/

    Eine Masterarbeit im Fokus der Kritik (Eine Masterarbeit ist eine Qualifikationsarbeit)

    Peter Conrad hat diese Arbeit nicht als Diplom-, sondern als Masterarbeit geschrieben. In Masterarbeiten können Studierende selber Themen vorschlagen und bearbeiten und wir helfen ihnen dann dabei, diese Arbeiten in der empirischen Durchführung zu optimieren.

    Wir haben mit einigen Autoren, die auf “scienceblogs” schreiben eine Diskussion zu diesem Thema geführt und sind in wesentlichen Punkten sogar zu einer Übereinstimmung gekommen. Diese betreffen vor allem den Kern der Arbeit. Dieser ist experimentell: Conrad hat ein dreifach verblindetes Experiment durchgeführt, in dem er per Zufall Ziele in seine selbstgebaute Anordnung gelegt hat.

    Was an einem Experiment unwissenschaftlich ist, hat mir bis jetzt weder einer der Reporter, die darüber berichtet haben noch einer der Science-Blogger erklären können. Im Gegenteil: alle haben darin zugestimmt, dass das Experiment an sich durchaus in Ordnung ist…

    Diese Wahrnehmungsverzerrung muss beim “Zu tief in die Röhre Schauen” entstanden sein…

  163. #167 Joseph Kuhn
    17. Mai 2012

    @ Ponder: Nochmals danke für den Link auf die neue Stellungnahme von Herrn Walach. An dieser Stellungnahme ist bemerkenswert, dass Herr Walach sich jetzt endlich kritisch zur Masterarbeit äußert, sowohl was die Form angeht als auch die zwischen ihm und dem Autor der Arbeit divergente Interpretation der Ergebnisse. Vermutlich hat ihn das einige Überwindung gekostet, das will ich durchaus anerkennen, aber die Kritik an der Arbeit fällt dennoch ziemlich halbherzig aus. Zum Verständnis dessen, wie Herr Walach eine Masterarbeit und die Aufgabe einer Betreuung sieht, gäbe es auch einiges anzumerken, aber das ist eine andere Sache.

    Mit welchen scienceblogs-Autoren das INTRAG eine Diskussion geführt hat, weiß ich nicht. Ich hatte einen einzigen Mailaustausch mit Herrn Schmidt, dem Zweitbetreuer der Arbeit. Auf meine Frage, ob er mit der Veröffentlichung dieses Mailaustausches einverstanden sei, hat er nicht mehr geantwortet. Da mit der neuen Stellungnahme von Herr Walach der Eindruck entstehen könnte, auch mit mir sei eine “Übereinstimmung in wesentlichen Punkten” erreicht worden, dokumentiere ich hier diesen Mailwechsel. Mit mir ist in keinem der entscheidenden Punkte, die die Masterarbeit betreffen, eine Übereinstimmung erreicht worden. Ich wüsste auch nicht, wo hierfür eine Grundlage bestehen sollte. Als diskussionswürdig sehe ich divergierente wissenschaftstheoretische Positionen, aber diese spielen bei der fraglichen Masterarbeit keine Rolle.

    Der Mailverkehr mit Herrn Schmidt:

    Gesendet: Samstag, 05. Mai 2012 um 16:28 Uhr
    Von: “Stefan Schmidt”
    An: josephkuhn@web.de
    Betreff: Wie definiert sich Wissenschaft

    Sehr geeherter Herr Kuhn,
    ich bin wie Sie wissen einer der Betreuer der Masterarbeit von Herrn
    Konrad. In ihrem Blog habe ich Ihre Kritik dazu gelesen. Wie Sie sich
    vorstellen können bin ich anderer Meinung. Da liese sich jetzt natürlich
    viel drüber schreiben, bloggen und publizieren.
    Ich habe ihre Schriftenverzeichnis auf Ihrer Homepage gesehen und das
    machte auf mich einen ganz guten Eindruck. Insofern dachte ich, es ist
    vielleicht einfacher, ein paar Dinge direkt und persönlich per Mail
    anzusprechen.
    Direkt kommentieren möchte ich allerdings nur zwei Aspekte.
    1. Das Kriterium für Wissenschaftlichkeit:
    Sie schreiben:
    “Davon abgesehen ist auch Walachs These, das einzige Kriterium von
    Wissenschaft sei gute Methodik, nicht unproblematisch. Demnach könnte
    man auch die Unterdruckexperimente des SS-Arztes Rascher im KZ Dachau
    als gute Wissenschaft durchgehen lassen. Irgendetwas fehlt
    offensichtlich in Walachs Bestimmung des Wissenschaftlichen. Gute
    Methodik ist nicht unabhängig davon, um welchen Untersuchungsgegenstand
    es geht und was dabei als Erkenntnisstand bereits gewonnen wurde.”
    Dem ist leider nicht so. Alle bisherigen Versuche in der
    Wissenschaftsphilosphie Wissenschaft über Inhalte zu definieren sind
    gescheitert. Wie sollte das auch gehen? Was wäre das Maß? Das gängige
    bisherige Weltbild (wie von ihnen vorgeschlagen) kann es definitv nicht
    sein, sonst wären ja allen konzeptuellen Neuentwicklungen per se
    unwissenschaftlich und müssten verboten werden. Also z.B. die
    Entwicklung der Quantentheorie Anfang letzten Jahrhunderts.
    Wie ist das jetzt mit Rascher und Dachau? Hier sprechen Sie eine
    ethische Bewertung der Wissenschaftlichen Tätigkeit an. Dies ist wohl
    eine Bewertung der Wissenschaft aber nicht der Wissenschaftlichkeit.
    Anders formuliert, ob Rascher eine gute (im Sinne von korrekte)
    Wissenschaft gemacht hat, hängt z.B. davon ab (auch wenn es pevers
    klingt) ob er den korrekten oder falschen statistischen Test verwendet
    hat. Diese Bewertung ist von einer moralischen grundverschieden. Hier
    ist eindeutig, dass seine Studien zutiefst unethisch und unmoralisch sind.
    Was die Guttenberg Arbeit angeht, so handelt es sich hier meiner Meinung
    nach um ein sowohl unethisches wie unwissenschaftliches Vorgehen.
    Ersters weil die Leistungen anderer als die eigenen ausgegeben werden,
    letzteres weil ein Gütekriterium wissenschaftlichen Arbeitens verletzt
    wurde (i.e. die Objektivierbarkeit durch korrektes Zitieren).
    Aus meiner Sicht bleibt es dabei, dass eine inhaltliche Entscheidung,
    was Wissenschaftlich ist und was nicht, ein Eingriff in die verbriefte
    akademische Freiheit wäre und in ihrer Konsequenz einer Zensur
    gleichkäme. Gegen ein solches Anliegen würde ich mich als
    Wissenschaftler immer mit ganzen Kräften wehren.

    2. Der zweite Punkt, der mir am Herzen liegt ist, dass sie in der
    Diskussion dieser Thematik die Gräueltaten der Nazis in Deutschland als
    Vergleich heranziehen. Dies sieht und hört man oft. Politiker die
    ähnliche Parallelen ziehen, fallen meist übelst auf die Nase. Warum?
    Letztendlich ist es meiner Meinung nach so, dass es sich hier um
    unvergleichliche und nicht relativierbare Ereignisse in der Geschichte
    der Menschheit handelt. Die Ereignisse des Holocauts nun aber zu
    bemühen, um über die Wissenschaflichkeit einer Masterarbeit zu
    diskutieren ist (neben dem, dass ich es geschmacklich als völlig
    unpassend empfinde) eine Relativierung dieser Gräueltaten, die sich aus
    meiner Sicht verbietet. Ich denke gerade wir Deutschen, sollten hier
    sehr vorsichtig sein, da die Taten ja von unseren Vorfahren verübt
    wurden und wir hier moralisch in der Pflicht stehen. Vieleicht ist Ihnen
    dieser Aspekt ja gar nicht in den Sinn gekommen, als Sie diesen
    Vergleich bemüht haben, aber ich denke mal, wenn Sie ihn mal aus dieser
    Perspektive sehen (die bei den Betroffenen und deren Nachfolger
    verbreitet ist) erkennen Sie auch, dass man hier schnell in eine
    unangenehme Position gelangt.
    Mit freundlichem Gruß
    S. Schmidt

    Gesendet: Samstag, 05. Mai 2012 um 20:15 Uhr
    Von: “Joseph Kuhn”
    An: “Stefan Schmidt”
    Betreff: Aw: Wie definiert sich Wissenschaft

    Sehr geehrter Herr Schmidt,
    zum ersten von Ihnen angesprochenen Punkt: Was “Wissenschaftlichkeit” und in der Folge das wissenschaftlich gewonnene “Wissen” konstituiert, müsste man sicher ausführlich diskutieren. Aber man kann Wissenschaft nicht nur über “gute Methodik” definieren. Erstens ist “gute Methodik” selbst nicht ahistorisch, d.h. man würde auch so keinen archimedischen Punkt der “Wissenschaftlichkeit” gewinnen. Zweitens ist es in sich widersprüchlich, eine “gute Methodik” als konstitutiv für “Wissenschaftlichkeit” zu sehen, die damit gewonnenen Ergebnisse aber sozusagen als belanglose Seifenblasen des damit vollzogenen Wissenschaftsprozesses abzutun. Es macht doch keinen Sinn, der Physik aufgrund ihres (im Wesentlichen) experimentellen Vorgehens “Wissenschaftlichkeit” zuzugestehen, die damit gewonnenen Ergebnisse aber in jedem neuen Experiment als völlig zur Disposition stehend betrachten. Der Begriff der “Bewährung” verliert da jede Substanz. Auf die umgekehrte Blickrichtung, dass der zu untersuchende Gegenstand auch bestimmend dafür ist, welche Methoden zu seiner Untersuchung angemessen sind, will ich nur noch einmal hingewiesen haben.

    Was den zweiten Punkt angeht: Die Zulässigkeit des Vergleichs mit Rascher wurde ja auch in den Kommentaren zu meinem Blogbeitrag infragegestellt. Ich habe daher dort in einem Kommentar klargestellt: “Hier wird nicht argumentiert, dass Herr Walach etwas macht, was moralisch mit den Nazi-Verbrechen auf einer Stufe steht. Das wäre ja auch absurd. Hier wird vielmehr argumentiert, dass sein Wissenschaftskriterium nicht ausreicht und nicht einmal eine Abgrenzung zu den – ebenfalls als “wissenschaftlich” deklarierten – Menschenversuchen damals aufzeigt.” Das halte ich aufrecht. Dass Sie die “Wissenschaftlichkeit” der Versuche Raschers von der Ethik seiner Versuche getrennt diskutieren wollen, zeigt ja genau das Dilemma, in das man mit einem Wissenschaftsbegriff kommt, wie Sie ihn hier vorbringen. Ein subjektwissenschaftlicher Ansatz, wie ihn z.B. Klaus Holzkamp und ähnlich auch andere handlungstheoretisch orientierte Psychologen ausformuliert hatten, käme nicht in diese Verlegenheit. Hier wird nämlich mit guten Argumenten das experimentelle Forschungsdesign für bestimmte humanwissenschaftliche Fragestellungen (die die Ebene des “Handelns” betreffen) als nicht gegenstandsadäquat abgelehnt, weil es die Versuchspersonen zu Objekten unter fremdgesetzten Bedingungen macht, sozusagen auf ein organismisches Niveau reduziert.

    Dies alles sind Dinge, die man diskutieren kann und für eine Weiterentwicklung gerade in den gesundheitswissenschaftlichen Fächern auch diskutieren muss. Aber sind Sie denn wirklich der Meinung, die Akzeptanz der Masterarbeit von Herrn Conrad hängt von den hier angerissenen Methodenfragen ab? Man muss bestimmt nicht den Trampelpfaden des akademischen Mainstreams folgen, aber man darf das wissenschaftliche Niveau nicht so unterlaufen, wie dies mit der Arbeit von Herrn Conrad geschehen ist. Hier liegt der Konfliktpunkt, nicht im Wissenschaftsverständnis. Wenn solche – ja auch formal ganz fragwürdige – Arbeiten Schule machen, leidet der Ruf der Gesundheitswissenschaften insgesamt, das ist der Punkt, um den es mir letztlich geht.

    Mit freundlichen Grüßen
    Joseph Kuhn

    P.S.: Sind Sie damit einverstanden, diesen Mailwechsel auf dem Blog öffentlich zu machen?

  164. #168 Basilius
    17. Mai 2012

    Herr Stefan Schmidt weicht also einer Auseinandersetzung mit den konkreten Problemen mit der Masterarbeit konsequent aus. Stattdessen wird die Freiheit der Wissenschaft alles zu tun, was ihr beliebt als Schutzschild aufgebaut.
    Und im Gegenzug findet er den Hinweis auf die ähnlich verlaufene Argumentation für z.B. menschenverachtende Versuche eines SS-Arztes als unangemessen, unpassend. Er tabuisiert jegliche vergleichende Auseinandersetzung mit solchen Themen hinfort und droht sogar noch sachte mit einem “auf die Nase Fallen”.
    Echte Argumente waren keine dabei.
    Schwache Leistung, aber hätte mich inzwischen auch eher gewundert. Oder habe ich was übersehen oder falsch aufgefasst?

  165. #169 noch'n Flo
    17. Mai 2012

    Ich muss mich hier Basilius dringend anschliessen:

    Stattdessen wird die Freiheit der Wissenschaft alles zu tun, was ihr beliebt als Schutzschild aufgebaut.

    Genau dagegen muss dringend angegangen werden. Denn wenn man diese Leute mit solcher Argumentation durchkommen lässt, wird die Reputation echter Wissenschaft auf Dauer in der Öffentlichkeit massiv beschädigt.

    Wer so etwas in offizieller Funktion an einer anerkannten Universität äussert, muss aus dem Wissenschaftsbetrieb schleunigst entfernt werden.

  166. #170 G.W.
    17. Mai 2012

    @Joseph Kuhn 17.05 00:54

    Vielen Dank für diese ausführlichen Erläuterungen, denen ich völlig zustimme.

    Sehen wir einmal davon ab, dass die der Arbeit zugrundeliegende “Theorie“ nicht den elementarsten Kriterien wissenschaftlicher Hypothesenbildung genügt (die immer ein Mindestmaß begründeter theoretischer und/oder empirisch-deskriptiver Hinweise erfordern), sondern ein reinrassiges Phantasieprodukt darstellt. Sehen wir auch davon ab, dass die doppelblinde Versuchsdurchführung nach den Eindrücken, die man aus der Arbeit gewinnen muss, keineswegs gesichert erscheint. Sehen wir auch davon ab, dass Darstellung und Auswertung der Daten unzulänglich, ja dilettantisch sind. Sehen wir auch davon ab, dass die schriftliche Ausarbeitung hanebüchen bis lächerlich ist. Es bleibt Folgendes:

    Wenn man eine Fragestellung wissenschaftlich bearbeiten möchte, die sowohl das Grundlagenverständnis der Physik als auch ihre Verbindung zur Kognition mit denkbar weitreichenden Implikationen zum Gegenstand hat, muss dies professionell und nicht hobbyistisch erfolgen. In jeder „normalen“ Disziplin wäre dies geschehen, und man hätte vor allem ein „durchwachsenes“ Ergebnis als Ansporn genommen, eine weitere, bessere Studie vorzunehmen. Dies zu tun steht den Herren frei, es kann ja aus Bordmitteln geschehen. Falls man also selbst die Fragestellung ernst nimmt und sie gemäß wissenschaftlichen Standards abklären möchte, sollte man seine Energie in eine Wiederholung des Versuchs investieren statt sich mit „Experiment an sich in Ordnung“ etc. herumzuwinden. Falls man den Versuch bereits von der Fragestellung her nicht ernst nimmt, sollte man sich nicht auf „Freiheit der Forschung“ hinausreden, solange man noch zu den Qualifikationen eines Wissenschaftlers die Fähigkeit zählt, Fragestellungen bezüglich ihrer Sinnhaftigkeit einzuschätzen, und es Laien überlässt, Narreteien zu folgen.

    Das beliebte Argument, Wissenschaft lasse sich nicht über Inhalte definieren, ist in diesem Zusammenhang belanglos. Es geht immer um Konkretes, und in Naturwissenschaft und Medizin kann man im konkreten Fall in der Regel sehr wohl entscheiden, ob etwas noch Wissenschaft ist oder nicht. Es ist auch immer wieder kurios, wenn man mit Quantentheorie, Revolutionen in der Physik etc. ankommt. Wollen sich die Herren und ihre Studenten im Ernst mit Heisenberg, Dirac, Feynman etc. vergleichen? Hat man einmal einen Blick in die Arbeiten solcher Leute geworfen?

    Was bleibt, ist der aus der Vergangenheit sattsam bekannte Eindruck, dass man jeweils ad hoc die Form, aber nicht das Ethos von Wissenschaft sucht. Es läge an Herrn Walach als Lehrstuhlinhaber, wenigstens von seiner Seite aus den so gut wie durchgängig halbseidenen Umgang von „Alternativmedizinern“ und dergl. mit Begriffen wie „Erfahrung“ und „Wissenschaft“ in einen soliden zu verwandeln.

  167. #171 Joseph Kuhn
    17. Mai 2012

    @ noch´n Flo: Die “Freiheit der Wissenschaft” ist, wie oben schon kommentiert, ein hohes Gut und zurecht nach Art 5 (3) Grundgesetz verfassungsrechtlich geschützt. Aber wer sich auf die Freiheit der “Wissenschaft” (!) beruft, sollte auch wissenschaftlich arbeiten und wissenschaftlich argumentieren. Es ist nicht alles Wissenschaft, was im Gewande der Wissenschaft daherkommt. Daher im Blogbeitrag auch der Hinweis auf die Radbruchsche Formel, die analog auf Grenzen des Rechtscharakters von Vorschriften im Gewande des Rechts abstellt.

    Wer an den Kozyrev-Spiegel glaubt, dem bleibt ja die Meinungsfreiheit, ebenfalls verfassungsrechtlich geschützt (Art. 5 (1) GG), mit anderen Worten, Unfug ist nicht per se verboten, aber er sollte sich eben nicht als Wissenschaft ausgeben.

  168. #172 Joseph Kuhn
    17. Mai 2012

    @ G.W.: Um es mit Herrn Walachs Worten auszudrücken: Wir stimmen in den wesentlichen Punkten überein. Danke übrigens für den Hinweis auf den von Michael Esfeld herausgegebenen Sammelband “Philosophie der Physik”. Schon gekauft, Sie haben für meine Urlaubslektüre gesorgt.

  169. #173 rolak
    17. Mai 2012

    Dem Dank an die hinweisende Empfehlung schließe ich mich fast ganz an: Bei mir wird es nicht im Urlaub gelesen werden ;-)

    Was mich die ganze Zeit ein wenig kratzt ist das Herumgereite auf der dreifachen Verblindung. Wäre ich gehässig, würde ich behaupten, Walach kannte bis dahin hin nur den Begriff ‘Doppelblindstudie’ und läßt jetzt ein ‘Ätsch, wir können einen mehr’ heraushängen.

  170. #174 G.W.
    17. Mai 2012

    @rolak 17:01

    Genau so dürfte es sein. Ganz simpel: einfach verblindet heißt, dass der Proband über die jeweils angewandte Alternative der Intervention nicht Bescheid weiß, zweifach verblindet, dass auch der Untersucher sie im Einzelfall nicht kennt. Eine Unterscheidung innerhalb der zweiten Stufe bedeutet nur: nicht komplett zweifach verblindet. Dreifach verblindet kann sinnvoll nur heißen, dass weder Untersuchter noch Untersucher überhaupt wissen, dass sie an einer Studie teilnehmen. Das wäre m.E. für die Homöopathie das erstrebenswerte Design, um willentliche und unwillentliche Beeinflussungen und den Selektionsbias so weit als möglich zu reduzieren, aber es ist natürlich ethisch als prospektive Studie nicht akzeptabel und, selbst wenn es akzeptabel wäre, nicht durchführbar.

    @Joseph Kuhn 16:16

    Falls Sie weitere freie Valenzen haben: zwei wunderbare Bücher über Wissenschaft (Why Beliefs Matter, Science in the Looking Glass, Oxford University Press) hat E. Brian Davies geschrieben, Professor emeritus (2010) für Mathematik am King’s College, London. Er gehört zu den Inauguratoren der Theorie offener (d.h. realistischer) Quantensysteme und hat gewichtige Lehrbücher über die Theorie linearer Operatoren geschrieben. Er kennt sich auch in Wissenschaftshistorie (Newton) sowie der Philosophie der Mathematik (wendet sich gegen den Platonismus) aus und hat darüber gut publiziert. Bei ihm verbinden sich Weite des Horizonts und Tiefgang, und dabei versteht er auch bei anspruchsvoller Materie ohne allzu viel Fachjargon zu schreiben. Ich kenne keinen deutschen Autor vergleichbaren Kalibers; die Physiker und Mathematiker reichen ihm philosophisch nicht das Wasser, die Philosophen nicht in Physik und Mathematik. Ein anderes gut lesbar geschriebenes und m.E. lesenswertes Buch ist das von Marcelo Gleiser: Die unvollkommene Schöpfung.

  171. #175 Joseph Kuhn
    17. Mai 2012

    @ rolak:

    “Was mich die ganze Zeit ein wenig kratzt ist das Herumgereite auf der dreifachen Verblindung.”

    Vielleicht zählt Herr Walach ja auch nur seine eigene (Betriebs-)Blindheit gegenüber dem Unfug in der Masterarbeit mit. Diese kleine Polemik sei mir gestattet, da Andreas Giesen, Webmaster des INTRAG, auf der oben von “Ponder” (16.5., 13:51) verlinkten Wikipedia-Diskussionsseite von einer “Hetzkampagne” spricht. Das ist eigentlich der typische Jargon ertappter Politiker. Kritisiert einer, ist es eine unmaßgebliche Einzelmeinung, kritisieren viele, ist es eine Hetzkampagne.

  172. #176 rolak
    17. Mai 2012

    Ganz so simpel ist es nicht, G.W., ‘dreifach verblindet‘ ist eine durchaus übliche Bezeichnung.

    Webmaster

    Vielleicht ist der Master ja auch im eigenen Hause erwürfelt worden..
    Nun, Joseph Kuhn, ‘Hetzkampagne’ scheint mir eine der pc-Varianten des sattsam bekannten Galileo-Gambits zu sein, in der Art ‘die anderen sind gegen mich, also muß ich doch recht haben’.

  173. #177 Joseph Kuhn
    17. Mai 2012

    @ G.W.: Danke für die literarische Fürsorge.

    @ rolak: Wenn man berechtigte Kritik als “Hetzkampagne” abtut, ist man die Last der inhaltlichen Auseinandersetzung mit der vorgebrachten Kritik erst einmal los, man weist die Legitimität der Kritik zurück, indem man ein sachfremdes Motiv (“Hetze”) unterstellt. Eine ad hominem-Spielart. Gleichzeitig verschiebt man die Auseinandersetzung von der inhaltlichen auf die soziale Ebene und stilisiert sich dabei als das unschuldige Opfer, appelliert also an die Solidarität des Publikums. Psychologisch nicht ungeschickt, ähnlich wie der Versuch, das Ganze als wissenschaftstheoretischen Dissens aufzuziehen (was mit der “Hetzkampagne” eigentlich nicht zusammenpasst). Diese rhetorischen Tricks funktionieren aber nur so lange, wie die Leute nicht in die Masterarbeit selbst schauen. Danach dürfte sich für die meisten die “Hetzkampagne” ebenso erledigt haben wie der “wissenschaftstheoretische Dissens”.

  174. #178 G.W.
    17. Mai 2012

    @rolak 22:00

    In der mir bekannten und vertrauten medizinischen Studienwelt ist der Unterschied zwischen doppelblind und dem im Wikipedia-Artikel genannten dreifachblind irrelevant oder nicht existent; deshalb habe ich diesen Begriff auch noch niemals verwendet. Die auswertenden Statistiker erfahren ja irgendwann im Laufe der Auswertung, worum es geht, und sie müssen es teils sogar, wenn etwa spezifische Vergleiche oder post hoc-Analysen gefordert sind. Dass Laborprobenanalysen verblindet erfolgen, versteht sich von selbst. Doppelt verblindet heißt gemäß dem mir bekannten Usus, das ALLE Beteiligten während der Analyse verblindet sind; sonst ist es nicht richtig doppelt verblindet. Entscheidend ist auch, dass die Qualitätssicherung der Daten (Ausreißerkontrolle usw.) im voll verblindeten Zustand erfolgt, damit da kein Bias hineingelangt. Was danach kommt, ist zumindest dann egal, wenn die statistische Auswertetechnik vorab festgelegt ist, wie es der Fall sein sollte.

  175. #179 rolak
    18. Mai 2012

    Hi G.W., über meine Meinung zum Sinngehalt der Formulierung habe ich mich nicht geäußert (entspricht Deiner), nur angemerkt, daß sie durchaus üblich sei.

    moin Joseph Kuhn, zum 3statt2 siehe ersten Absatz, zur Hetzkampagne: Gerade las ich einen post bei dem intelligenten Computer und fühlte mich intensiv an das F/O-Gemastere bzw die aufjaulenden Reaktionen seitens Walach et al erinnert. Als Bindeglied des Denkens höchstwahrscheinlich ‘Volksverhetzung’…

  176. #180 G.W.
    18. Mai 2012

    @rolak 09:39

    Danke für die Antwort. Vierfach verblindet agieren vermutlich diejenigen, die überhaupt nicht mehr wissen, was sie tun. Danke auch für den link. Bedenkt man, wieviel der dort kritisierten Art zu allen möglichen Themen kursiert und welchen Zuspruch es hat, dann ist man davon kuriert, an das animal rationale zu glauben. Oder vielmehr: man sieht, dass dieser Begriff unterbestimmt ist, indem Verstand im Sinne der Fähigkeit, grammatikalisch korrekte Sätze bilden zu können etc., nichts über Vernunft impliziert, und letzteres war ja bei Aristoteles etc. wesentlich gemeint.

  177. #181 Joseph Kuhn
    18. Mai 2012

    @ G.W.: Die vierte Verblindung ist der “bias blind spot”, der bei den Frankfurtern wohl recht groß geraten ist.

    @ Ponder: Eine zweite Falschmeldung der von Ihnen oben verlinkten Stellungnahme Walachs hatte ich bisher gar nicht wahrgenommen. Er schreibt:

    “Was an einem Experiment unwissenschaftlich ist, hat mir bis jetzt weder einer der Reporter, die darüber berichtet haben noch einer der Science-Blogger erklären können. Im Gegenteil: alle haben darin zugestimmt, dass das Experiment an sich durchaus in Ordnung ist.”

    Ich habe nicht zugestimmt, bei mir steht oben (6.5.; 16:38) vielmehr das Gegenteil: “Der Zusammenhang zwischen Theorie, Beobachtungssätzen und Versuchsaufbau ist unklar.” Ob es überhaupt einen “Science-Blogger” gibt, der ihm da zugestimmt hat?

    Sehr schön ist auch diese Sentenz aus der Stellungnahme: “Eine Masterarbeit ist per Definition keine wissenschaftliche Publikation, sondern eine reine Qualifikationsarbeit. Nicht umsonst sind diese auch nicht über Bibliotheken zugänglich. Dass sie nun öffentlich geworden ist, ist nicht in Ordnung und ist auch ohne unser Wissen und ohne Wissen und Billigung des Autors geschehen.” Eine Masterarbeit ist zwar an sich noch keine wissenschaftliche “Publikation”, sie muss nicht veröffentlicht werden, aber folgt daraus, dass sie auch keine wissenschaftlichen Standards erfüllen muss? Und sehr glaubhaft ist es auch nicht, dass die Arbeit sozusagen geisterhaft ins Internet gelangt ist, aber auch hier gilt: was folgt daraus? Was wäre an der ganzen Geschichte besser, wenn die Arbeit im Verborgenen geblieben wäre?

  178. #182 rolak
    18. Mai 2012

    Nun ja, was auch immer sich Herr W unter einer Masterarbeit vorstellt

    Zur Qualitätssicherung sieht die Kultusministerkonferenz für Masterstudiengänge obligatorisch eine Abschlussarbeit (Masterarbeit) vor, „mit der die Fähigkeit nachgewiesen wird, innerhalb einer vorgegebenen Frist ein Problem aus dem jeweiligen Fach selbständig nach wissenschaftlichen Methoden zu bearbeiten.“ (src)

    Dieser Nachweis wird in keiner Weise mit einer Publikationspflicht verknüpft, sollte also auch ohne diese erbracht werden – was in diesem Fall schwerlich nachzuweisen wäre. Das erachte ich für die (zumindest eine) Motivation im Argumentationswechsel seitens der IntraG.

    ohne Wissen und Billigung des Autors

    Bei Fostac? Die damit werben? Immer noch? Schwer vorstellbar – doch im Falle-daß wäre dies ein Anlaß für eine saftige Ausgleichszahlungs-Klage. Die höchst erstaunlicherweise noch nicht angestrengt wurde…

  179. #183 Joseph Kuhn
    18. Mai 2012

    @ rolak: Die Stellungnahmen des INTRAG, inzwischen sind es ja schon vier, sind höchst aufschlussreiche Dokumente, die sicher früher oder später ihren Niederschlag in einer wissenschaftssoziologischen Arbeit finden werden. Schon jetzt reicht das Material rund um diese Masterarbeit für eine schöne Fallstudie. Vermutlich wird sie nicht in Frankfurt/O. geschrieben.

  180. #184 Ponder
    18. Mai 2012

    @ Joseph Kuhn:

    Da biete ich gern meine Hilfe an – zumal ich schon etwas eingearbeitet bin ;)

  181. #185 Joseph Kuhn
    21. Mai 2012

    In der SCIENCE-Ausgabe vom 18.5.2012 ist ein Hinweis auf die Frankfurter Masterarbeit erschienen. Diese Ehre wird nur wenigen Masterarbeiten zuteil. Im summary heißt es: “A recent master’s degree thesis at European University Viadrina Frankfurt (Oder) in Germany is generating waves—though not the “time waves” the student was looking for.”

    Quelle: http://www.sciencemag.org/content/336/6083/787.1.summary

  182. #186 G.W.
    22. Mai 2012

    @Joseph Kuhn

    Danke für diesen Hinweis. Es steht nur zu hoffen, dass diese höfliche, jedoch in der Scientific Community nicht prestigesteigernde Erwähnung den Effekt der Debatte um die Arbeit wenigstens soweit verstärkt, dass sie eine Art Warnschuss wird. Die deutschen Forschungsförderer zumindest sind stark daran interessiert, im internationalen Vergleich gut dazustehen, und das betrifft auch zumindest die größeren Universitäten.

    Herr Walach soll ja nicht in seiner Forschungsfreiheit eingeschränkt werden und ruhig „am Rande“ des Etablierten tätig sein, da gibt es m.E. im Übergangsfeld von Medizin und Psychologie viele interessante Fragestellungen. Aber es sollte doch kein aus den raumzeitlich gewellten Fingern gesogener, physikalisch absurder und überdies dilettantisch bearbeiteter aluminisierter Rundfug sein, von den dahinter stehenden offenkundigen Vermarktungsinteressen abgesehen. Der physikalische Hintergrund der Hypothese ist es, der mich nach wie vor fassungslos macht. Hat man denn nie Fachleute der Physik gefragt, ob das fensteröffnende Quantengebrabbel irgendeinen Sinn ergibt? Und muss es für einen studierten Psychologen nicht näher liegen, die Visionen der Probanden ganz trivial zu erklären?

  183. #187 Joseph Kuhn
    22. Mai 2012

    @ G.W.: Das sehe ich genauso. Forschung an Außenseiterthemen ist o.k., nur soll es eben Forschung sein und keine Wissenschaftsscharlatanerie. Schade, dass man nicht weiß, was Herr Walach wirklich über die Masterarbeit denkt, was dem Druck der Medien geschuldete taktische Verteidigungsargumente sind und was nicht. Dass man gegenüber Herrn Conrad eine andere Lösung hätte finden müssen als die Abnahme und Auszeichnung dieser Masterarbeit, sollte eigentlich auch Herrn Walach bei ruhigem Nachdenken einleuchten. Und als “Warnschuss”, wie Sie es nennen, dürfte die verheerende Medienresonanz jedenfalls bei denen, die vernünftig mit solchen Sachen umgehen wollen, schon wahrgenommen werden.

  184. #188 Ponder
    23. Mai 2012

    @ G.W.:

    Der physikalische Hintergrund der Hypothese ist es, der mich nach wie vor fassungslos macht. Hat man denn nie Fachleute der Physik gefragt, ob das fensteröffnende Quantengebrabbel irgendeinen Sinn ergibt?

    Hier zur Erläuterung des “physikalischen Hintergrunds” ein Schmankerl zu “Global Scaling” – auf Müllers Thesen bezieht sich immerhin Peter Conrad in seiner Arbeit.

    http://www.energeticmedizin.com/ingeniumbioniksystem/globalscalingansatz/index.html

  185. #189 Ponder
    23. Mai 2012

    Von einer weiteren Master-Thesis ist hier auch die Rede – allerdings wurde sie in Graz/Schloss Seggau vorgelegt

    http://www.energeticmedizin.com/ingeniumbioniksystem/ingeniummatrix36trinity/masterthesisingenium/index.html

    http://www.ingenium.me/downloads/IngeniumUniMasterThesis.pdf

  186. #190 Joseph Kuhn
    24. Mai 2012

    Gestern hat das Brandenburgische Wissenschaftsministerium auf meine Bitte um Stellungnahme geantwortet:

    “Sehr geehrter Herr Dr. Kuhn,
    Frau Ministerin Professor Kunst dankt Ihnen für Ihre Email vom 25.04.2012, in der Sie um Stellungnahme zur wissenschaftlichen Qualität einer im Rahmen des Master-Studienganges „Kulturwissenschaften und Komplementäre Medizin“ an der Europa-Universität Viadrina angefertigten Abschlussarbeit bitten. Die Ministerin hat mich gebeten, Ihnen zu antworten. Grundsätzlich ist es nicht Aufgabe des Ministeriums, zu einzelnen akademischen Arbeiten Bewertungen vorzunehmen. Dies liegt in erster Linie in der Zuständigkeit der Hochschulen sowie der verantwortlichen Professorinnen und Professoren. Ich gebe Ihnen aber Recht, dass die vorliegende Arbeit Anlass bietet zu prüfen, ob in dem Studiengang die allgemeinen Qualitätsstandards für wissenschaftliches Arbeiten eingehalten werden. Das Ministerium wird daher den Stiftungsrat der Stiftung Europa-Universität Viadrina, der die Rechtsaufsicht über die Hochschule ausübt, mit der Angelegenheit befassen. Der Stiftungsrat kann nach Abschluss der Untersuchung die notwendigen Maßnahmen ergreifen, um die Einhaltung akademischer Standards in dem Studiengang zu sichern. Mit freundlichen Grüßen …”

    Das scheint mir eine sehr gute Entscheidung zu sein, weil das Ministerium damit einerseits signalisiert, dass es die Sache ernst nimmt, andererseits das Weitere zunächst “wissenschaftsintern” regeln lässt und damit der Freiheit von Forschung und Lehre Rechnung trägt.

    Dieser Verlauf ist ein Erfolg der vielen Stimmen, die im Internet und in den Medien in dieser Angelegenheit laut geworden sind. Danke daher auch an alle, die hier Kommentare geschrieben haben.

  187. #191 rolak
    25. Mai 2012

    Jo, das ist der normale Gang: Bei bedenklichen Zuständen ‘von oben’ die zuständigen Gremien um erhöhte Aufmerksamkeit anhalten, Lauf der Dinge abwarten, ggfs weitere Schritte einleiten. Der den (vermuteten) gordischen Knoten zerhackende berühmte Engel mit flammendem Schwert ist mir zwar vom Gefühl her wesentlich lieber, aber eher kontraproduktiv..

    Schön zu sehen, daß die bürokratische Mechanik noch nicht zum Stillstand gekommen ist, wir dürfen uns über die jeweils Wochen dauern könnenden Päuslein zwischen den Handlungsfetzen nur nicht einlullen lassen…
    Vielleicht sollte ich mir einen wöchentlich zu inspizierenden Text ‘und dann war da noch’ zulegen, der an den WEn zusammen mit den WE-blogs abgeklappert wird. Och, das klingt gut, werde ich mit dem hier behandelten Thema gleich erstellen ;-)
    (Beleg, ja, mein desktop ist recht sauber, ein darauf geknüpfter Ordner enthält direkt­zu­griffige Dateien)

  188. #192 Ponder
    25. Mai 2012

    Die Märkische Allgemeine vom 24.05.:

    http://www.anonym.to/?http://www.maerkischeallgemeine.de/cms/beitrag/12332332/64289/Das-Institut-fuer-transkulturelle-Gesundheitswissenschaften-an-der-Viadrina.html

    …Eine erst kürzlich bekannt gewordene, im März 2011 eingereichte Masterarbeit des Orthopäden Peter Conrad weckt den Verdacht, an dem von Harald Walach geleiteten Institut würden auch Narreteien als wissenschaftliche Leistung durchgewunken…

    …Der Text, der dies theoretisch untermauern soll, wimmelt von merkwürdigen physikalischen Annahmen.
    Zeit könne „Energie ohne Impuls übertragen“, heißt es oder auch: „Zeitübertragung erfolgt instantan = mit unendlicher Geschwindigkeit“. Conrad hantiert dabei mit quantenphysikalischem und relativitätstheoretischem Vokabular, als habe er seinen Doktor in theoretischer Physik und nicht in Medizin erworben.

    Hermann Nicolai, einer der Direktoren des Max-Planck-Instituts für Gravitationsphysik in Potsdam, sagt über einen Abschnitt der Einleitung:

    „In der Tat sind die Aussagen entweder trivial oder völlig unsinnig. Wie so oft in solchen Fällen lohnt nicht einmal der Versuch, zu verstehen, was der Autor gemeint haben könnte.“ Aus physikalischer Sicht sei das alles „einfach nur Quatsch“…

    …Walach selbst hat in Psychologie und Philosophie promoviert. Freidenkerkreise sehen ihn als Urheber einer Pseudowissenschaft namens „Schwacher Quantentheorie“. Diese soll die Wirkung der Homöopathie, ein Forschungsgebiet Walachs, erklären.

    Der Präsident der Viadrina, Gunter Pleuger, möchte sich vorläufig nicht zu der Auseinandersetzung äußern.
    Derzeit begutachte noch die Strukturkommission des Landes Brandenburg die Viadrina. Sich vor dem 8. Juni über das „Institut für transkulturelle Gesundheitswissenschaften“ auszulassen, hieße, dem Bericht der Kommission vorzugreifen. (Von Rüdiger Braun)

  189. #194 Joseph Kuhn
    9. Juni 2012

    @ Ponder: Danke für die Links.

    Auch wenn die inhaltliche Argumentation der Strukturkommission sehr “diplomatisch” ist, die Empfehlung ist umso eindeutiger (im Bericht der Strukturkommission auf Seite 200):

    “Die Hochschulstrukturkommission empfiehlt der EUV aus strukturellen und qualitativen Gründen nachdrücklich den künftigen Verzicht auf das Angebot des MA-Studienganges „Kulturwissenschaften – Komplementäre Medizin“. Eine Fortführung des Instituts für transkulturelle Gesundheitswissenschaften ist weder wie bisher als In-Institut noch als An-Institut zu befürworten.”

  190. #195 Ponder
    10. Juni 2012

    @ Joseph Kuhn:

    Und schon wieder Neuigkeiten – der Einfachheit halber und natürlich aus puren niederen Eigenwerbungs-Motiven ;-) mach ich das diesmal so:

    http://blog.esowatch.com/?p=8206#comment-19148

  191. #196 Joseph Kuhn
    10. Juni 2012

    Dann füge ich auch noch einen Link zu einer Fortsetzung der Diskussion hinzu – in das Nachbarblog Mathlog, in dem es um Mathematikmissbrauch bei der sog. “schwachen Quantentheorie” geht:
    http://www.scienceblogs.de/mathlog/2012/06/nichtkommutative-komplementrmedizin-und-die-viadrina.php

  192. #197 Ponder
    11. Juni 2012

    @ all:

    Andreas Giesen vom IntraG diskutiert grad bei Esowatch im Blog

    http://blog.esowatch.com/?p=7765#comment-19197

    und im Forum

    http://forum.esowatch.com/index.php?topic=5306.msg100210#msg100210

    Herzliche Einladung zum Mitdiskutieren in unserer subversiven Spelunke ;-)

  193. #198 Joseph Kuhn
    12. Juni 2012

    Herr Walach geht juristisch gegen die Medien vor, die – möglicherweise im Detail fehlerhaft – über Esoterik im Studiengang berichtet haben. Nach der Abmahnung der FAZ, die hier schon verlinkt wurde, gibt es nun auch eine einstweilige Verfügung gegen Spiegel online. So kann man eine Auseinandersetzung natürlich auch führen.

    Da drängt sich die Frage auf, warum sich derzeit Andreas Giesen, nach eigener Auskunft Webmaster des INTRAG, auf Esowatch so intensiv um Diskussion bemüht.

  194. #199 Ponder
    12. Juni 2012

    @ Joseph Kuhn:

    Da drängt sich die Frage auf, warum sich derzeit Andreas Giesen, nach eigener Auskunft Webmaster des INTRAG, auf Esowatch so intensiv um Diskussion bemüht.

    Offen gestanden: ich denke nicht, dass er dies aus der Motivation heraus tut, uns justiziable Äußerungen zu entlocken ;-)

    Oder falls dies der Plan war, hat er sich gegen ihn selbst gewendet.
    Er hat bei uns im Blog kommentiert mit Formulierungen, die geeignet sind, den IntraG-Sachverhalt zu entschärfen, zu relativieren und zu verschleiern.

    Daraufhin habe ich ihn ins Forum eingeladen – auch um ihm die Möglichkeit zu geben, in einem nicht ganz so öffentlichen Rahmen seine Argumente zu präzisieren und sich den Fragen von uns Esowatchern zu stellen.

    Den Diskussionsverlauf kennen Sie: “Pudding” ist gar kein Ausdruck – leider.

    Ich bin gespannt, ob da noch Entwicklungsmöglichkeiten drin sind, um es mal vorsichtig optimistisch zu formulieren.
    Er sollte zumindest begriffen haben, dass er seine Vorwürfe präzisieren und vor allem am konkreten Beispiel demonstrieren muss.

    Für mich ist sein Wischiwaschi eine gute Gelegenheit, ihn mit der Quellenlage zu konfrontieren.
    Es gibt außerdem zum IntraG noch so einiges an Fundstücken, die Esowatch noch nicht aufgearbeitet hat. Ggfs würden wir Sie in Einzelfällen um Ihre Einschätzung bitten.

    LG, Ponder

  195. #200 Ponder
    12. Juni 2012

    So fing das Ganze an – im Blogartikel sind der Übersichtlichkeit halber noch mal die gesammelten Widersprüchlichkeiten zusammengestellt:

    http://blog.esowatch.com/?p=7765

    Und hier kommt Andreas Giesen ins Spiel:

    http://blog.esowatch.com/?p=7765#comment-19169

  196. #201 Ponder
    13. Juni 2012

    @ Joseph Kuhn:

    Lieber Joseph Kuhn,

    zunächst bitte ich in aller Form stellvertretend um Verzeihung für das, was Sie sich da vom IntraG-Webmaster in unserem Forum haben Gefallen lassen müssen!
    Fremdschämen ist angesagt, und ich bin innerlich immer noch auf 180 ob so viel Dreistigkeit.

    Aber das hat mich angestachelt, noch etwas nachzufassen und mir die “Dozenten” mal wieder näher anzuschauen.

    Dabei gab es eine kleine Überraschung. ;-)

    http://www.scenar.ch/tl_files/scenar/doc/scenar_pruefung_universitaerer_scenar_therapeut.pdf

    Näheres und drum herum:

    http://forum.esowatch.com/index.php?topic=5306.msg100615#msg100615

  197. #202 Joseph Kuhn
    13. Juni 2012

    @ Ponder: Es gibt keinen Grund, sich für stellvertretend für irgendetwas zu entschuldigen. Da bin ich von der Tabaklobby ganz andere Dinge gewohnt. Ich fand die Diskussion auf dem Esowatch-Forum vielmehr sehr aufschlussreich, weil sie die Argumentationsstrukturen von Herrn Giesen in unerwartet klarer Form offen gelegt hat. Im Esowatch-Forum ist auf diese Weise ein interessantes Dokument entstanden.

    Zur “Scenar-Medizin”: Bei Pubmed findet man 4 Artikel, alles keine aussagekräftigen Studien. Mit stichhaltigen Wirksamkeitsbelegen scheint es also nicht weit her zu sein. Wenn man googelt, was sich hinter dieser Technik verbirgt und was sie alles bewirken soll, hört es sich ziemlich seltsam an. Um mich näher damit zu beschäftigen, fehlt mir allerdings die Zeit, daher bin ich etwas vorsichtig mit einem Urteil.

  198. #203 Dr. Webbaer
    13. Juni 2012

    aus der Begründung der Unterlassungsklage gegen die FAZ:

    Zum einen ist die Süddeutsche Zeitung keine zuverlässige Quelle und zum
    anderen war Ihnen vor Erscheinen des Artikels hinreichend dargelegt worden, dass und warum der Artikel der Süddeutschen Zeitung falsch war.

    Die falsche Tatsachenbehauptung wird auch nicht dadurch richtig, dass seitens des Instituts unseres Mandanten eine Zusammenarbeit mit der DGEIM beabsichtigt war.

    Die SZ ist sicherlich keine zuverlässige Quelle, auch wenn hier wohl Juristendeutsch gesprochen worden ist und etwas anderes gemeint war, interessant aber die ausdrückliche Bestätigung, dass eine Zusammenarbeit mit der DGEIM geplant war, mit oder ohne dem Benannten (was die Rechtspflege nun zu prüfen hat).

    MFG
    Dr. Webbaer

  199. #204 Basilius
    13. Juni 2012

    Die Diskussion mit dem werten Herrn Giesen habe ich inzwischen auch nachverfolgt. Man kann tatsächlich sagen, daß die Argumentationsstrukturen offen dargelegt wurden. Was sehr neutral und höflich ausgedrückt ist. Ich kam aus dem Kopfschütteln jedenfalls nicht mehr heraus.
    Diesen Scenar-Apparatismus habe ich auch kurz überflogen. Das ist ja die volle Lachnummer. So eindeutig als haltlosen Eso-Quacksalber-Quatsch identifizierbar. Die Dreistigkeit für so einen simplen Apparat viel Geld zu verlangen ist ja nichts neues. Ebensowenig daß die dafür “notwendigen” Seminare noch teuer sind. Aber daß man dafür jetzt Zertifikate von dieser besagten Universität bekommen kann ist wirklich der Gipfel.
    Dabei wird in den Diskussionen (nicht nur von Herrn Giesen) immer wieder betont, daß ja quasi sämtliche Auffälligkeiten, so man sie denn nicht mehr schön- und klein reden kann, ausschließlich Einzelfälle seien, an denen man doch nicht die Verurteilung der gesamten Uni festmachen dürfe.
    Ich habe langsam den Eindruck, daß es zumindest für einen Lehrstuhl eher genau umgekehrt wäre.

  200. #205 Joseph Kuhn
    13. Juni 2012

    @ Basilius:

    Solche Zertifizierungen haben etwas Seltsames. Sie nähren sich vom guten Leumund der wissenschaftlichen Welt, deren Spielregeln man ansonsten nicht anerkennen will.

    In diesem Zusammenhang ist auch eine der Ausführungen von Herrn Giesen im Esowatch-Forum aufschlussreich:

    “Der Studiengang wurde von einer unabhängigen Akkreditierungsagentur akkreditiert, mit ein paar Empfehlungen und Auflagen, die alle bereits in der neuen SPO umgesetzt sind. Das wäre sicher nicht geschehen, wenn der Studiengang das wäre, wie Du es hier formulierst. Eine solche Agentur ist ihrerseits akkreditiert und müsste um ihre Existenz fürchten, wenn sie nicht die notwendigen Maßstäbe ansetzen würde und etwas durchwinken würde, was nicht akkreditierbar ist. Es KANN also so schlimm nicht sein.”
    http://blog.esowatch.com/?p=7765#comment-19197

    Ich hoffe, das gibt der Akkreditierungsagentur in Freiburg zu denken, siehe auch den letzten Absatz meines ursprünglichen Blogbeitrags.

  201. #206 Basilius
    14. Juni 2012

    @Joseph Kuhn
    Ja, das kennt man ja auch von anderen Anhängern unwissenschaftlicher Irrlehren. Jeder Homöopath zum Beispiel findet wissenschaftliche Studien auf einmal ganz dufte, wenn sie ihm bloß sein Weltbild bestätigen.
    Ansonsten sind sie eher des Teufels oder zumindest so grob vereinfachend/ungenau/unpersönlich, daß er sie lieber ablehnt.
    Die Geschichte mit den Zertifizierungen und Akkreditierungen läuft letztlich immer wieder auf diesen geistigen Kurzschluss hinaus, in dem einfach reihum sich gegenseitig bestätigt wird, wie dufte man doch seine Sache macht.
    Oder eben gegen Geld.
    Titelmühlen arbeiten letztlich auch nicht anders. In Stiftungen oder unabhängigen Vereinen mit eindrucksvollen Namen kann man sich auch schöne Pöstchen mit toller Reputation zukommen lassen.
    Alles sehr sumpfig dort…

  202. #207 G.W.
    14. Juni 2012

    Gerade gesehen. Leider hatte die Polizei seinerzeit noch nichts vom Kozyrev-Spiegel gehört:
    http://www.fr-online.de/neonazi-terror/nsu-ermittlungen-nsu-helfer–frei—-medium–sollte-helfen,1477338,16382974.html
    Man fragt sich, wohin so etwas noch führen soll.

  203. #208 ZetaOri
    14. Juni 2012

    Bzgl. Behauptung von Giesen:

    “Der Studiengang wurde von einer unabhängigen Akkreditierungsagentur akkreditiert, [...]

    Ich kann in der Datenbank des Akkreditierungsrates, …
    Suchmaske hier: http://www.hs-kompass2.de/kompass/xml/akkr/maske.html
    … keinen Studiengang “Kulturwissenschaften — Komplementäre Medizin” finden, auch keinen mit ähnlicher Bezeichnung, weder unter Kultur noch unter Medizin.
    Bin ich zu blöd, habe ich etwas falsch verstanden oder haben die ihn schon rausgeschmissen?

  204. #209 Basilius
    14. Juni 2012

    Da würde ich doch mal ganz frech vermuten, daß er von Anfang an noch nie drin gewesen ist ZetaOri. Jedenfalls, bis einer der Herren Akkreditierungbehaupter uns einen schlüssigen Beleg vorweisen kann.
    Zeigt mal wieder, daß man auch noch kleine Krümelbehauptungen nachprüfen sollte.

  205. #210 ZetaOri
    14. Juni 2012

    @Basilius· 14.06.12 · 20:19 Uhr

    Da würde ich doch mal ganz frech vermuten, daß er von Anfang an noch nie drin gewesen ist [...]

    Ja, das habe ich auch vermutet, aber ich wollte ja nicht gleich …öh, … mir der Tür und so …, na, Du weißt schon. ;D

  206. #211 Basilius
    14. Juni 2012

    Ist schon klar ZetaOri. Das ist ja auch viel eleganter, wenn man sich die Bälle so wie beim Fußball zuspielt (obwohl ich sonst für Fußball nichts übrig habe. Das ist mehr ein Fall für meine andere Hälfte).

  207. #212 para
    14. Juni 2012

    Hier wurde der Studiengang akkreditiert.
    Allerdings kann ich den Studiengang auch nicht beim A-Rat finden.
    Die Akkreditierung war am 27.05. 2011 (s. hier).
    Akkreditierung des Masterstudiengangs KWKM “Kulturwissenschaften – Komplementäre Medizin” eingetragen von IntraG am 21.02.2012 18:12

  208. #213 ZetaOri
    14. Juni 2012

    @para· 14.06.12 · 22:43 Uhr

    Hier wurde der Studiengang akkreditiert.
    Allerdings kann ich den Studiengang auch nicht beim A-Rat finden. [...]

    Hmm, vielleicht ist der jetzt ein wenig ‘diskreditiert’? Aber das hier: …

    Akkreditierte Studiengänge
    Gelistet sind hier alle durch die AHPGS akkreditierten Studiengänge nach Hochschulstandorten. Bitte beachten Sie, dass die angeführten Informationen dem Zeitpunkt der jeweiligen Akkreditierung entsprechen. Die Informationen werden während der Akkreditierungsfrist nicht aktualisiert. Einen aktuellen Überblick mit weitergehenden Informationen finden Sie in der Datenbank des Akkreditierungsrates.
    (Stand: 22.05.2012)

    … könnte zumindest darauf hindeuten, dass er mal in der Datenbank des Akkreditierungsrates WAR.
    Und der Eintrag selber bei der AHPGS scheint ja tatsächlich nicht sehr aktuell zu sein:

    Frankfurt am Oder

    (Himmel hilf, jetzt haben die unsere gute alte Oder auch schon `ner Geschlechtsumwandlung unterzogen >;o)

    Komplementäre Medizin – Kulturwissenschaften – Heilkunde, Master of Arts
    Europa- Universität Viadrina Frankfurt (Oder)
    Die Kurzdarstellung des Studiengangs befindet sich derzeit im Erstellungs- bzw. Abstimmungsprozess.

    (Hervorhebungen von mir)

  209. #214 para
    15. Juni 2012

    Was mich zudem wundert ist, dass man mit dem Eintrag im IntraG bald 9 Monate gewartet hat um dies zu erwähnen. Das ist ja nun nicht irgendeine beiläufige Nachricht. Selbst im Newsletter ist die Nachricht alles andere als “frisch” — Datum (in Adresszeile) 09.2011.

  210. #215 Ponder
    15. Juni 2012

    Dazu im EsowatchBlog Andreas Giesen:

    …Der Studiengang wurde von einer unabhängigen Akkreditierungsagentur akkreditiert,

    mit ein paar Empfehlungen und Auflagen, die alle bereits in der neuen SPO umgesetzt sind.

    Das wäre sicher nicht geschehen, wenn der Studiengang das wäre, wie Du es hier formulierst. Eine solche Agentur ist ihrerseits akkreditiert und müsste um ihre Existenz fürchten, wenn sie nicht die notwendigen Maßstäbe ansetzen würde und etwas durchwinken würde, was nicht akkreditierbar ist. Es KANN also so schlimm nicht sein…

    http://blog.esowatch.com/?p=7765#comment-19187

    Es wäre interessant zu erfahren, worin die Empfehlungen und besonders die Auflagen im einzelnen bestanden – und wie sie tatsächlich umgesetzt wurden.

  211. #216 celsus
    15. Juni 2012

    Nur um noch mal den Realitätsabstand der an dieser “Masterarbeit” beteiligten Personen aufzuzeigen

    Diese Arbeit zeigt: die Kozyrevsche Zeitwellentheorie ist mit den Ergebnissen dieses Experimentes NICHT zu belegen. Sowohl das experimentelle als auch das konzeptuelle Vorgehen der Arbeit ist dabei strikt wissenschaftlich.

    Aus “Am Rande” auf http://intrag.info/newsletter/2011-09/#1

    vs.

    Die Wirksamkeit der Spiegel halte ich für erwiesen wegen:
    - der Ergebnisse der Vorexperimente
    - der Ergebnisse im Testarm 2 “offen” für den Spiegel

    Aus http://www.fostac.ch/de/docs/kurse/kozyrev-prinzip-masterarbeit-dr.med.-peter-conrad-2011.pdf

  212. #217 ZetaOri
    15. Juni 2012

    @para· 15.06.12 · 01:07 Uhr
    @Ponder· 15.06.12 · 09:50 Uhr
    Habe gerade noch ein wenig gewühlt. Wie ein Studiengang in die Datenbank des AR kommt ist hier detailliert ausgeführt. Danach gibt es 3 denkbare Szenarien, von denen jedoch zumindest nach aktuellem Stand keines so richtig zutrifft.
    Da nach dem PDF die Akkreditierungsdaten quasi ein Anhängsel des Datensatzes beim Hochschulkompass sind, habe ich dort mal gesucht:

    Suchergebnis
    Treffer 1 bis 1 von ingesamt 1 Treffer
    Sie haben auf http://www.hochschulkompass.de nach folgenden Kriterien gesucht:
    Studientyp: beides Studienort: Frankfurt (Oder) Fachsuche: Komplementäre Medizin
    Kulturwissenschaften – Komplementäre Medizin Master Universität Frankfurt (Oder) Frankfurt (Oder) weiterführend

    Suchergebnis
    Sie haben auf http://www.hochschulkompass.de nach folgenden Kriterien gesucht:
    Studientyp: beides Studienort: Frankfurt (Oder) Akkreditiert: Ja Fachsuche: Komplementäre Medizin
    Kein Treffer

    Das entspräche erstmal Scenario 1, aber dann hätte die AHPGS die Akkreditierungsdaten einpflegen und der AR diese nach Prüfung freischalten müssen, was offensichtlich nicht erfolgt ist.
    Scenario 2 trifft nicht zu, da der Datensatz im Hochschulkompass vorhanden ist, Scenario 3 dito, da der Studiengang längst angelaufen ist.
    Denkbar wäre, dass durch die Umbenennung durch die EUV von
    “Komplementäre Medizin – Kulturwissenschaften – Heilkunde” (KMKH)
    in
    “Kulturwissenschaften – Komplementäre Medizin” (KWKM)
    (vielleicht war das ja eine der Auflagen, um bei einem Studiengang an einer kulturwissenschaftlichen Fakultät etwas von der fetten Überbetonung komplementärer Heilerei wegzukommen?)
    beim Hochschulkompass ein neuer Datensatz angelegt wurde, in dem die Akkreditierungsdaten noch fehlen. Dann sollte aber zumindest unter den alten Stichworten beim AR etwas zu finden sein. Ist aber nicht:

    Suche beim Akkreditierungsrat:
    Studienort: Frankfurt (Oder) Studienfach: ohne Angabe 11 Treffer, kein passender
    Studienort: Frankfurt (Oder) Studienfach: Kultur 5 Treffer, kein passender
    Studienort: Frankfurt (Oder) Studienfach: Kulturwissenschaft 0 Treffer
    Studienort: Frankfurt (Oder) Studienfach: Komplementäre Medizin 0 Treffer
    Studienort: Frankfurt (Oder) Studienfach: Medizin 0 Treffer
    Studienort: Frankfurt (Oder) Studienfach: Heilkunde 0 Treffer

    Vielleicht helfen ja die FAQ beim AR weiter? Ah, da:

    Frage 5: Was bedeutet es, wenn ein Studiengang nicht in der Datenbank akkreditierter Studiengänge auf der Website des Akkreditierungsrates aufgelistet ist?

    Antwort 5: Ist ein Bachelor- oder Masterstudiengang nicht in der Datenbank des Akkreditierungsrates aufgelistet, können im Wesentlichen folgende Gründe vorliegen:
    a) der Studiengang ist noch nicht akkreditiert;
    b) das Verfahren zur Akkreditierung des Studiengangs ist noch nicht abgeschlossen;
    c) der Studiengang ist bereits akkreditiert, der entsprechende Datensatz muss von der für das Verfahren zuständigen Agentur aber noch angelegt werden;
    d) der Studiengang wird von eine privaten, nicht staatlich anerkannten Bildungseinrichtung oder von einer ausländischen Hochschule angeboten;
    e) der Antrag auf Akkreditierung des Studiengangs ist negativ beschieden worden. Die immatrikulierten Studierenden genießen Vertrauensschutz, Neuimmatrikulierungen sind nicht möglich.
    Um herauszufinden, welche dieser möglichen Ursachen zutrifft, müssen Sie sich an die den Studiengang anbietende Hochschule wenden. Der Akkreditierungsrat wird seitens der Agenturen ausschließlich über abgeschlossene Verfahren informiert.

    Hmm, nee, hilft auch nicht wirklich, da ist ja alles Mögliche möglich. ;o)
    Und der Empfehlung im vorletzten Satz zu folgen wäre unter den gegebenen Umständen wohl auch nicht sehr zielführend. Habe daher erstmal die federführende AHPGS angemailt, mal schauen ob die antworten.

  213. #218 Basilius
    15. Juni 2012

    @ZetaOri
    Da bist Du wirklich sehr fleißig gewesen.
    Auf eine mögliche Antwort darf man jedenfalls gespannt sein. Hier sind ja letztlich nur Fragezeichen bezüglich der behaupteten Akkreditierung zu finden.
    Ich gehe derzeit erst mal davon aus, daß hier nichts (jedenfalls nicht erfolgreich) akkreditiert wurde und die Behauptungen dazu analog zu den widersprüchlichen Behauptungen um den (Nicht-)Nachweis der kozyrevschen Zeitwellentheorie zu interpretieren sind.
    -_-

  214. #219 Joseph Kuhn
    16. Juni 2012

    In einem Interview, das die taz heute veröffentlicht hat, verteidigt Herr Walach die Masterarbeit erneut. “Ich finde die Substanz dieser Arbeit gut”, wird er zitiert. Die Kritik daran wird als “postmoderne Inquisition” abgewatscht. Warum “postmodern”, erschließt sich mir zwar nicht, aber sei´s drum, es klingt zumindest gut. Gegen diese Inquisition nimmt Herr Walach für sich und seine Anhängerschaft folgerichtig in Anspruch, die “Speerspitze der Aufklärung” zu sein. Ob das nach den Debatten der letzten Wochen noch als Chuzpe zu bezeichnen ist, oder eher schon als Realitätsverlust? Offensichtlich ist von all der Kritik an der Masterarbeit nichts, aber auch gar nichts bei Herrn Walach angekommen.

    Das ganze Interview ist nachzulesen unter:
    https://www.taz.de/Professor-ueber-Alternative-Heilkunde/!95412/

  215. #220 Ponder
    16. Juni 2012

    @ ZetaOri:

    Vielen Dank für deine Unterstützung.
    Wir sind da auch grad dran…

    @ all:

    Die Webseite mit dem universität geprüften Scenar-Therapeuten ist mittlerweile schon gelöscht.
    Glücklicher Weise gibt es aber einen Screenshot.

    Ähnliches geschah damals im Umfeld unserer Recherchen zur Zusammenarbeit mit der DGEIM etc.

    Wenn jemand künftig auf verwertbare Hinweise auf Webseiten stößt, bitte zur Sicherheit immer sofort eine Kopie davon machen ;-)

  216. #221 rolak
    16. Juni 2012

    sofort eine Kopie davon machen

    Aber nur im Notfall via screenshot, möglichst webcitation nutzen!

  217. #222 Joseph Kuhn
    16. Juni 2012
  218. #223 rolak
    16. Juni 2012

    Tach Joseph, als pdf dürfte es noch in deinem browser-cache liegen, da empfiehlt sich ggfs ein (offizielles) Abspeichern als Datei an einer leicht wiederfindbaren Stelle.
    Denn hier gibt es das übliche 404 (jibbet nich, vertippt oder was?).

  219. #224 Joseph Kuhn
    16. Juni 2012

    @ rolak: In der Tat. Das Dokument ist gesichert, danke für den Hinweis.

    Auf der Internetseite http://www.scenar.ch/referenzen.html kann man übrigens Folgendes lesen:

    “Zu den mittlerweile über 6700 SCENARtherapeuten in den deutschsprachigen Ländern zählen auch folgende Institutionen:
    •Universität Potsdam
    •Universität Frankfurt Oder”

    Deine Universität, dein Therapeut – das wirft Fragen auf.

    Und etwas weiter unten auf der gleichen Seite:

    SCENAR-Therapie ist Teil des Masterstudiengangs „Komplementäre Medizin – Kulturwissenschaften – Heilkunde“ der Europa-Universität Viadrina in D-Frankfurt (Oder).

    Das wiederum beantwortet manche Fragen.

  220. #225 rolak
    16. Juni 2012

    Schöne Seite, immerhin wird dort angeben, daß die SCENAR-Therapie

    Teil des Masterstudiengangs „Komplementäre Medizin – Kulturwissenschaften – Heilkunde“ der Europa-Universität Viadrina in D-Frankfurt (Oder).

    ist. Selbstverständlich zeigt die url ins Nirvana, ist dieser DGEIM-konforme Ausbildungs­punkt bei einer der jüngeren -äh- Überarbeitungen unter den Tisch gefallen, weil ja nach Auffälligwerden möglichst nicht mehr sein sollte, was nie sein durfte, auf daß in Interviews und sonstigen Statements gesagt werden kann, es wäre nie so gewesen.

    Hat ein bißchen was von CSI :-)

  221. #226 rolak
    16. Juni 2012

    Da hat aber einer einen Anhang nachgeliefert^^
    Bei den sich aufwerfenden Fragen war doch eben schon Schluß – oder sollte ich bei Marathonsitzungen auf gar so viel Koffein verzichten? Ach was, der zweite Tag geht auch noch, das Progrämmchen soll laufen, ich geh mal Wasser wärmen.

    Doch um auf die Aufwürfe zurückzukommen: Die ganze site macht seit der unzufälligen Erstbesteigung den Eindruck eines mehr schlecht als recht zusammengeschusterten Textaggregates. Sinnfreie Kombination

    Unsere Referenzen reichen daher mittlerweile vom täglichen Einsatz in vielen Praxen und Reha-Kliniken bis zum Spitzensportbereich

    (stellte der Einsatz und nicht wie sonst der Anwender die Ref aus?) über syntax lost in editing

    finden Sie eine Ausschnitt

    (wohlwollend die Erstformulierung ‘Auswahl’ annehmend) oder die schon von Dir erwähnten Kategorienfehler, zB

    Ausschnitt der Athleten[:] … Motorsport.

    Das sieht alles nicht sooo rund aus.

  222. #227 Joseph Kuhn
    16. Juni 2012

    @ rolak: Ja, den Rest des Kommentars habe ich nachgeliefert. Mit dem schönen Nebeneffekt, dass ich mit dem Zitat zur Viadrina schneller war, endlich mal ;-)

  223. #228 G.W.
    16. Juni 2012

    @Joseph Kuhn 16.06. 00:06

    Danke für den Hinweis auf dieses Interview. Es gehört zum Überheblichsten (im wörtlichen Sinne), was mir je untergekommen ist. Diese Mann HAT den Kontakt zur Realität verloren; er nennt sogar die Auswertung „korrekt“, womit er sich in meinen Augen ganz konkret wissenschaftlich disqualifiziert. Der Rest ist überkommenes Propagandavokabular: „positivistisch“ etc. Offenbar hat dieser „Wissenschaftshistoriker“ keine nennenswerten Kenntnisse der Anschauungs- und Arbeitsweise moderner Wissenschaft, die keineswegs so eng ist, wie er suggeriert, aber eben auch nicht für jeden Unfug offen. Dass er nicht nur unter der Kritik an der Conrad-Arbeit leidet, sondern auch unter der an seiner ins Beliebige verallgemeinerten Quantentheorie, ist anzunehmen und dürfte die Reaktion verstärkt haben. Gerne erwarten wir in Zukunft die großen wissenschaftlichen und therapeutischen Durchbrüche inklusive Nobelpreise von Seiten von Raumzeitlochbohrern der Firma Conrad.

    Dass die Erforschung von Kulturen und die Propagierung ihrer Methoden im Bezahlstudium zwei verschiedene Dinge sind, scheint ohnedies keine Rolle zu spielen; das Institut heißt ja nicht „Institut für transkulturelle Therapie“. Ebenso wenig, dass die Nachfrage seitens Ärzten nach meiner Wahrnehmung zum weitaus überwiegenden Teil kommerziell bestimmt ist.

    Dass Herr W. die Frage nach Qualitätskontrolle in die nach Forschungsförderung, und zwar durch Krankenkassen, ummünzt, ist klar. Wo soll die Forschung denn stattfinden? Bei ihm und seinen statistisch-methodologisch so ausgewiesenen Kollegen? Die von Herrn W. genannte Kasuistiken-Datenbank zur Qualitätskontrolle ist nach aller vernünftigen Erwartung wissenschaftlich wertlos, denn sie wird im Wesentlichen vom Selektionsbias „positiver“ Resultate bestimmt sein, solange a) keine Pflichterfassung vorliegt und b) der Dokumentationsaufwand aller möglicherweise relevanten erklärenden Randbedingungen sich in realistischen Grenzen halten soll. Auch die sogenannte Wissenschaftlichkeit folgt eben nur dem simile-Prinzip. Datenbank –> erwartbarer Effekt –> Alles Wissenschaft. Man könnte das Interview nur lächerlich finden, man kann es aber auch in seiner Selbstgewissheit und Trickserei widerlich finden.

  224. #229 ZetaOri
    16. Juni 2012

    @rolak· 16.06.12 · 16:06 Uhr

    Schöne Seite, immerhin wird dort angeben, daß die SCENAR-Therapie
    Teil des Masterstudiengangs „Komplementäre Medizin – Kulturwissenschaften – Heilkunde“ der Europa-Universität Viadrina in D-Frankfurt (Oder).

    ist.

    Jo, und auf scenar.de findet man einen gewissen Peter Conrad zusammen mit einer Frau Barbara als “Therapeuten in Ihrer Nähe” , dort firmierend als Dr. med., und dass hier keine Verwechselung mir dem namensgleichen Dipl.-Med. vorliegt, läßt sich anhand der Adresse leicht eruieren. Die Wahrscheinlichkeit, dass der ‘Dr. med.’ der Frau Barbara zuzuordnen ist, dürfte wohl auch gering sein, wie ihr zumindest ehemaliger und noch aufzufindender Eintrag als Beraterin für “Meridian-Energie-Techniken nach Franke®” (MET) vermuten lässt (gut 10 Bildschirmseiten scrollen):

    Frau Barbara Conrad – MET-Beraterin®
    Mitarbeiterin in Orthop. Praxis

    Da liegt wohl einiges ‘in der Familie’, sowohl in der kleinen als auch in der ganz großen. >;D

  225. #230 Joseph Kuhn
    17. Juni 2012

    @ G.W.:

    “Die von Herrn W. genannte Kasuistiken-Datenbank zur Qualitätskontrolle ist nach aller vernünftigen Erwartung wissenschaftlich wertlos”

    In der Tat. Die sog. “Anwendungsbeobachtungen” der Pharmaindustrie gelten zurecht als problematisch, viele davon als methodisch wertlos, in der Komplementärmedizin will Herr Walach das trotzdem einführen. Und die taz fragt nicht einmal nach. Das war kein Glanzlicht des Medizinjournalismus. Ganz davon abgesehen, dass zweifelhaft ist, ob die taz überhaupt einen Blick in die abermals verteidigte Masterarbeit getan hat, auch da fehlen ja die Nachfragen an den relevanten Stellen. Das Interview wirkt insgesamt so, als ob man Herrn Walach eine Bühne für seine Verteidigung bieten wollte. Da gibt es wohl nach den Empfehlungen der Hochschulstrukturkommission Bedarf.

  226. #231 Joseph Kuhn
    17. Juni 2012

    Sehr nett übrigens auch dieses “medizinjournalistische” Interview von Edith Kresta:
    http://www.taz.de/1/archiv/archiv/?dig=2001/08/13/a0158
    Nachzufragen scheint nicht ihr Stil zu sein.

  227. #232 G.W.
    17. Juni 2012

    @Joseph Kuhn 17.06. 11:10

    Mit Ihrer Vermutung dürften Sie richtig liegen. Wenn sich die Klientel des Herrn W. in einer überregionalen Tageszeitung vermehrt finden dürfte, dann unter den Lesern der taz. Es genügt diesem Publikum gegenüber, Phrasen wie „Inquisition“, „positivistisch“ „Speerspitze der Aufklärung“ (fragt sich, wer da tot auf der Strecke bleibt) usw. in die Runde zu werfen, um verlässlich die „kritischen“ Reflexe auszulösen. Ich hatte Herrn W. bislang immer noch einen „Vorschuss“ gegeben, da ich ihn als durchaus auch differenziert erlebt habe. Dieses Kapital ist mit dem Interview ganz und gar verspielt.

    Die Datenbank wäre ja übrigens nicht einmal eine Anwendungsbeobachtung (unter denen es repräsentative, verlässliche, gute gibt), denn ohne umfassenden Dokumentationszwang ist der multiple reporting bias (Arzt, Patient) bei einem Thema wie „Komplementärmedizin“ so gut wie sicher.

  228. #233 Joseph Kuhn
    17. Juni 2012

    @ G.W.: Ja, die taz spricht bevorzugt das gutsituierte alternative Milieu an und Teile davon pflegen eine ziemlich realitätsignorante Affinität auch zu seltsamen komplementärmedizinischen Anschauungen. Da ist man dann ganz nahe bei den Masernpartys und der z.B. in anthroposophischen Kreisen verbreiteten Impfskepsis, die im Umfeld ihrer Kitas und Schulen regelmäßig zu Masernausbrüchen führt.

  229. #234 para
    17. Juni 2012

    Noch so eine Randbemerkung. Auf der Hompage von Fostac wird die Masterarbeit noch immer als pdf angeboten.
    Man findet sie unter den Kursangeboten (weit unten, Titel “Erfahrungstag mit dem Kozyrev Spiegel”), nicht jedoch unter dem Menüpunkt “Studien”.
    Angekündigt wird sie mit dem Titel

    Masterarbeit zum Kozyrev Spiegel von Dr. med. Peter Conrad

    (Hervorhebung durch mich)

  230. #235 Ponder
    18. Juni 2012

    Weitere IntraG-Verflechtungen wurden u.a. hier protokolliert:

    http://forum.esowatch.com/index.php?topic=5306.msg101078#msg101078

  231. #236 Basilius
    18. Juni 2012

    @Ponder
    So!
    Jetzt habe ich den ganzen Thread mit dem Herrn Giesen gelesen. Anfangs war ich ja noch versucht in die Diskussion einzusteigen, aber einerseits kamen die wichtigsten meiner Einwürfe von den anderen dort und andererseits erscheint mir tatsächlich eine weitere Diskussion mit Herrn Giesen nur der eigenen Unterhaltung dienlich. Aber dafür ist mir die Zeit dann doch zu schade.
    Nichtsdestotrotz finde ich dann solche Artikel in der SZ wieder aufbauend, da man die Hoffnung genährt bekommt, man könne einen kleinen Teil beitragen:
    Europa-Universität Viadrina Esoterik-Institut vor dem Aus?
    Was mich noch interessiert hätte ist, wieso ich ⇒hier eigentlich ohne weiteren Kommentar so nett zitiert werde? Mir ist nicht ganz klar, was da ausgesagt werden sollte. Naja, vielleicht frage ich doch noch mal dortselbst nach. Aber eigentlich bin ich immer zu faul, mir einen neuen Account für irgendwas zu zu legen.

  232. #237 Ponder
    18. Juni 2012

    Harald Walach hat soeben eine neue Stellungnahme zur Masterarbeit veröffentlicht – hier zusammenfassende Anmerkungen von Stefan Schmidt:

    http://intrag.info/aktuell/2012/06/18/der-kozyrev-spiegel-und-peter-conrads-masterarbeit-%E2%80%93-einige-zusammenfassende-beobachtungen/

    http://intrag.info/archiv/Masterarbeit-Conrad-Kozyrev-Spiegel_Fazit_Harald-Walach.pdf

    Mir ist nicht ganz klar, was da ausgesagt werden sollte. Naja, vielleicht frage ich doch noch mal dortselbst nach.

    Aber bitte doch ;-)

  233. #238 Joseph Kuhn
    18. Juni 2012

    @ Basilius: Danke für den Hinweis auf den neuen Artikel in der Süddeutschen. Das ist wohl der Ausgleich für das seltsame taz-Interview von Herrn Walach. Wird ja hoffentlich kein Verschränkungsphänomen entsprechend der “schwachen Quantentheorie” Walachs sein, sondern nur ein wenig höhere “Mediengerechtigkeit”.

    Dass Sie bei Esowatch kommentarlos zitiert werden: Ich vermute mal, Ihr Kommentar sprach einfach für sich selbst.

  234. #239 Basilius
    18. Juni 2012

    @Joseph Kuhn
    Keine Ursache, aber der Dank für den Hinweis auf den SZ-Artikel gebührt ursprünglich Daggi. Er hatte da zuerst drauf hingewiesen.

  235. #240 Joseph Kuhn
    18. Juni 2012

    Die Stellungnahme von Herrn Walach ist ja witzig. Da räumt er formale Defizite der Arbeit ein, reduziert das aber mehr oder weniger auf Stilfragen und wischt alles andere wie gehabt wieder beiseite. Dass zu den formalen Defiziten auch die fehlende Literaturrecherche zum Thema zählt, dass zu den formalen Defiziten auch die unzureichende Diskussion der Limitationen der Untersuchung zählt – gerade mal am Rande geht Walach darauf ein, von den übrigen in Blogs und andernorts aufgelisteten Problemen der Arbeit ganz zu schweigen. Ich will das nicht noch einmal wiederholen. Auch zu dem erneuten Ausweichen auf eine wissenschaftstheoretische Ebene, um die es hier gar nicht geht, will ich nichts mehr sagen, dazu wurde schon genug gesagt.

    Etwas unappetitlich sind nach erstem Überfliegen seiner Stellungnahme zwei Punkte: Die Arroganz, mit der er seinen Kritikern Unkenntnis unterstellt und suggeriert, besser als alle anderen zu wissen, was Wissenschaftlichkeit ist, das zieht sich durch den ganzen Text, und dann die Dreistigkeit der rhetorischen Frage unter Punkt 4 seiner Stellungnahme, “(…) wenn es jemand um echtes Interesse gegangen wäre, hätte er uns dann nicht zunächst fragen können, was wir uns dabei gedacht haben? Warum wir die Arbeit durchgelassen haben?” Genau das ist ja geschehen. Seine unwirsch abwehrende Reaktion auf ein Mail eines Kollegen an ihn war Auslöser des Blogbeitrags hier.

    Interessant wiederum ist sein Auflisten von Betreuungsleistungen und Publikationen. Dass
    er das so vorzeigen muss, kann man vielleicht so interpretieren, dass er irgendwo doch merkt, dass sein Ruf auf dem Spiel steht. Leider wird er dieser Herausforderung nach wie vor nicht gerecht.

    Kommentarkorrektur 22.6.2012, 18.40 Uhr: Ursprünglich folgte nach dem Hinweis auf die fehlende Literaturrecherche ein Halbsatz, dass Herr Walach diesen Kritikpunkt geflissentlich übergehen würde. Das war nicht nicht korrekt. Er geht in seiner Stellungnahme darauf ein, das habe ich überlesen, er gewichtet diesen Kritikpunkt aber nicht angemessen.

  236. #241 Ponder
    19. Juni 2012

    Quantec macht inzwischen auch ganz direkt Werbung mit der oben schon mal verlinkten Masterarbeit zur Therapie von Heuschnupfen:

    http://www.quantec.eu/deutsch/newsletter/newsletterbeitraege/quantec_newsletter_201203.php#Box2

    Ich hab es gesichert, aber mehrfach hält besser…

    http://www.esowatch.com/ge/index.php?title=Quantec

  237. #242 Joseph Kuhn
    19. Juni 2012

    Herr Schmidt, der zweite Gutachter der Masterarbeit, hat mich heute noch einmal kontaktiert. Man bemüht sich offensichtlich um eine direktere Kommunikation, aber inhaltlich gibt es nichts wirklich Neues. Hier sein Mail und meine Antwort:

    “Gesendet: Dienstag, 19. Juni 2012 um 12:28 Uhr
    Von: “Stefan Schmidt”
    An: “Joseph Kuhn”
    Betreff: Re: Aw: Wie definiert sich Wissenschaft
    Sehr geehrter Herr Kuhn,
    ich hatte ihnen damals nicht mehr auf Ihre Mail geantwortet, da ich mit mehreren anderen Dingen streng in Beschlag genommen war, dann verging die Zeit, es kamen die Pfingstferien. Letzte Woche haben Herr Walach und ich uns nochmals an das Chaos gemacht, dass die Conrad’sche Masterarbeit hier verursacht hat. Wir haben mal einige Punkte zusammengetragen und Bilanz gezogen. Es wurde klar, dass wir im öffentlichen Umgang mit diesem Thema einige Fehler gemacht haben. Das Thema und die Brisanz hat uns überrascht, die Arbeit war ja schon ein Jahr alt und wir haben die verschiedenen Ebenen der Kritik (Methode und Formale Darstellung) zunächst nicht richtig unterschieden. Auf dieser Basis hat Herr Walach eine längere Darstellung unserer Sichtweise geschrieben, ich habe das ganze in einer kürzeren Erklärung zusammengefasst und das wurde gestern bei uns auf den Intrag-Blog gestellt (http://intrag.info/aktuell/#_blank). Vielleicht finden Sie Zeit sich das kurz anzuschauen. Einige Themen aus Ihrer letzten Mail werden dort ganz gut behandelt, finde ich.
    Wenn ich Ihre untenstehende Antwort jetzt nochmals neu lese, finde ich ehrlich gesagt nicht, dass unsere Positionen weit auseinander sind. Wenn ich Sie richtig deute, sagen sie dort, dass es schwierig ist einen archimedischen Punkt für Wissenschaflichkeit zu finden, und das heißt ja auch, ich interpretiere, dass man Conrad nicht wegen seinem Thema oder seinem Experiment Unwissenschaftlichkeit vorwerfen kann?
    Das ‘Methode’ nicht ahistorisch ist, ist sicherlich richitg. Ich denke die Methode muss der Fragestellung angemessen sein und geeignet sein diese (unter Berücksichtung des momentan bekannten Methodenspektrums) korrekt zu beantworten.
    Weiterhin heißt das nicht, dass es keine Bewährung von Erkenntnissen gibt und man nicht auf bisherige Erkenntnisse aufbauen sollte. Diese Schlussfolgerung, die Sie aus meiner Argumentation ziehen, teile ich nicht. Das wäre ja furchtbar, ich plädiere sogar selbst dafür (siehe paper zu Replikation im Anhang). Aber ich bin dagegen, dass man sich ausschließlich auf Bewährung verlässt (in einem positivistischen Sinne) weil man sonst (a) keine neuen Modelle entwerfen und testen könnte (Die Relativitiätstheorie wäre aus ihrer Perspektive unwissenschaftlich) (b) man eine Möglichkeit schaffen würde, dass Aussenseitertheorien, die vom Mainstream abweichen, (Stichwort orthodoxes vs. heterodoxes Wissen) nicht mehr empirisch überprüft werden könnten. Ich finde aber genau, dass das der beste Umgang mit Aussenseiter- oder abweichendem Wissen ist, sei es Alternativmedizin oder Parapsychologie. Debattieren kann man da endlos, aber ein gut gemachtes Experiment zu diesen Themen ist meist viel erleuchtetender und auf jedenfall spannende Wissenschaft. Das ist doch gerade die Stärke des wissenschaflichen Ansatzes, dass er durch den empirischen Zugang Klarheit schaffen kann. Und diese Option, finde ich, dürfen wir uns nicht durch zensurähnliche Maßnahmen verhindern.
    Ich bin mir sicher, dass das nicht ihr Interesse ist, aber durch Ihr Vorgehen, fördern Sie geradezu (meine Meinung) pluralismuseinschränkende und die wissenschaft beschränkende Kräfte in dieser Debatte. Hier tut ein Blick nach England gut (fair play Haltung) oder in die USA wo die Alternativmedizin, weil man weiss, dass die Leute sie sowieso benutzen, großflächig auf Staatskosten evaluiert wird. Wissenschaft erweist sich in diesem Fall als ein kraftvolles Instrument, und das ganz ohne Denk- und Handlungsverbote. Dies ist unser Anliegen mit dem Institut. Mit guter Methodik an Fragestellungen ran gehen, die die viele Leute in der Öffentlichtkeit beschäftigen, aber von der Wissenschaft oft aus irrationalen Gründen gemieden werden.
    Hinsichtlich ethischer Aspekte vielleicht noch kurz ein Wort. Der von ihnen skizzierte Holzkamp’sche Ansatz ist mir sympathisch. Aber Sie und ich wissen, dass so die Wissenschaft heute nicht funktioniert. Im momentan gültigen Diskurs werden ethische Fragen und Fragen der korrekten aus dem wissenschaftlichen Vorgehen abgeleitete Erkenntnisse auf separaten Ebenen behandelt. Deswegen müssen ja Ethikkommissionen über die Studienanträge hier im Klinikum oder über die Möglichkeiten, die sich aus wissenschaftlichem Handeln ergeben (Stammzellen etc.), befinden. Aber ich glaube, das müssen wir nicht weiter vertiefen, da Sie Herrn Conrad wohl kein unethisches Handeln vorwerfen?
    Mit freundlichem Gruß
    S. Schmidt

    P.S. Diesen Mailwechsel dürfen Sie übrigens gerne (vollständig und unverändert) veröffentlichen.”

    Mit der im Mail von Herrn Schmidt erwähnten “untenstehenden Antwort” ist mein Antwortmail vom 5.5.2012 an Herrn Schmidt gemeint, dieser Mailverkehr ist oben, Kommentar 17.05.12 · 00:54 Uhr, dokumentiert. Meine Antwort auf sein heutiges Mail:

    “Gesendet: Dienstag, 19. Juni 2012 um 17:46 Uhr
    Von: “Joseph Kuhn”
    An: “Stefan Schmidt”
    Betreff: Aw: Re: Wie definiert sich Wissenschaft

    Sehr geehrter Herr Schmidt,
    vielen Dank für Ihre Erläuterungen. Inhaltlich möchte ich im Einzelnen nicht mehr darauf eingehen, die Argumente sind hinreichend ausgetauscht, vor allem was die Masterarbeit angeht. Was die von Ihnen angeführten allgemeinen wissenschaftstheoretischen Aspekte angeht, hatte ich schon in meiner ersten Mail gesagt, dass man dies ausführlicher diskutieren müsste, insofern will ich es auch hier dabei belassen. Nur am Rande sei angemerkt, dass Ihr Rekurs auf die wissenschaftlichen Gepflogenheiten am Ende Ihrer Mail (zur Trennung ethischer und inhaltlicher Fragen) nicht dazu passt, dass Sie eben jene Gepflogenheiten (z.B. wie mit “bewährtem Wissen” umzugehen ist) ansonsten gerne übergehen, um frei im Umgang mit esoterischen Themen zu sein. Das wirkt doch etwas beliebig, aber wie gesagt, solche Fragen wären ausführlicher zu diskutieren, mit der Qualität der Masterarbeit haben sie ohnehin nichts zu tun.
    Mit freundlichen Grüßen
    Joseph Kuhn”

  238. #243 Ponder
    19. Juni 2012

    @ Joseph Kuhn:

    Das ist interessant zu lesen, was der Herr Schmidt da schreibt:

    Wenn ich Ihre untenstehende Antwort jetzt nochmals neu lese, finde ich ehrlich gesagt nicht, dass unsere Positionen weit auseinander sind. Wenn ich Sie richtig deute, sagen sie dort, dass es schwierig ist einen archimedischen Punkt für Wissenschaflichkeit zu finden,

    und das heißt ja auch, ich interpretiere, dass man Conrad nicht wegen seinem Thema oder seinem Experiment Unwissenschaftlichkeit vorwerfen kann?

    Ich denke die Methode muss der Fragestellung angemessen sein und geeignet sein diese (unter Berücksichtung des momentan bekannten Methodenspektrums) korrekt zu beantworten. …

    Nun, ich finde mit am fragwürdigsten am Experimentalteil, dass Peter Conrad die Vorversuche mit einem – ebenfalls selbst gebauten – großen Spiegel macht, in dem die Versuchsperson selbst Platz nimmt.

    Für das eigentliche Experiment verändert er aber ohne weitere Begründung den Versuchsaufbau entscheidend.

    …2. Vorexperimente

    Einen ersten Kozyrev-Spiegel bastelte ich Ende 2008 (Abb. 1). Dieser besteht
    aus einer innen mit Aluminiumfolie verkleideten Plastikröhre mit einem
    Durchmesser von ca. 90,6 cm – einem Knotenpunkt nach Global Scaling.

    Erfahrungen im Inneren dieser Konstruktion wurden von mir selbst und
    mehreren Bekannten gemacht.
    Diese entsprachen teilweise den von M.
    Schmieke beschriebenen: Gefühl zu fliegen, Empfangen von Informationen,
    telepathische Kontakte, Wahrnehmung vergangener Lebensepisoden.
    Darüber hinaus erleichterte und verschnellerte das Innere des Spiegels die
    Induktion einer Selbsttrance bis hin zur Kontaktaufnahme mit verstorbenen
    Angehörigen. Außerdem verbesserte ein 10 – 30 minütiger Aufenthalt das
    körperliche Wohlbefinden z.B. bei körperlicher Erschöpfung oder grippalem
    Infekt….

    Somit ändert Conrad nicht nur den aus Vorversuchen bekannten Versuchsaufbau, sondern (implizit) ändert sich damit auch die ganze Fragestellung:

    …Die Idee, einen kleinen, transportablen Kozyrev-Spiegel zu bauen, entspringt
    ebenfalls einer Abbildung von M. Schmieke: Kozyrev-Spiegel, welche im Time
    Waver integriert sind.
    Eine Frage, die sich mir stellte war: Kann ein (miniaturisierter) Kozyrev-Spiegel
    intuitives Wissen fördern?

    3. Fragestellung und Studienziele
    Die Fragestellung lautet: Kann ein kleiner Kozyrev-Spiegel einfachster Bauart
    die intuitiven Fähigkeiten eines Probanden verbessern?

    http://www.fostac.ch/de/docs/kurse/kozyrev-prinzip-masterarbeit-dr.med.-peter-conrad-2011.pdf

    In der ersten Versuchsanordnung wird die “Wirkung” des Spiegels auf die in ihm sich befindende Person getestet (wie im Vorversuch beschrieben).

    In der darauf folgenden Versuchsanordnung soll was eigentlich präzise ??? getestet werden? – Die “Informationsaufnahme und -übertragung mittels Global Scaling kalibrierter Kabel aus einem kleinen Spiegel in das Bewusstsein der Versuchsperson “draußen”?

    Es gibt also ein Wirrwarr im Versuchsaufbau, noch verstärkt durch die unpräzise formulierte zu testende Hypothese.

    Es kann also gerade in diesem Beispiel keine Rede davon sein, dass, wie Herr Schmidt formuliert,

    “die Methode der Fragestellung angemessen sei und geeignet … diese (unter Berücksichtung des momentan bekannten Methodenspektrums) korrekt zu beantworten.”

    Dem von mir geschilderten Dilemma widmet Harald Walach in seiner 8-seitigen Darstellung leider nur die Fußnote (1) …

  239. #244 Ponder
    19. Juni 2012

    Harald Walach und die pseudomedizinischen Firmenverflechtungen – das hat schon seit Freiburg Tradition:

    http://www.quantec.eu/deutsch/pdf/22UniFreiburg.pdf

    … Da wir seit mehreren Jahren in den Praxen unserer Kunden beobachten können, dass sich diese bewusstseinsorientierten Prozesse mit QUANTEC® auch instrumentalisieren lassen, sind wir gerne auf den Vorschlag von Herrn Prof. Walach und Herrn Dr. Schneider (Institut für Umweltmedizin und Krankenhaushygiene am Universitätsklinikum Freiburg) eingegangen, eine Studie mit der Fragestellung durchzuführen, ob sich unsere empirischen Beobachtungen in einer wissenschaftlichen Studie erhärten lassen…

    … Das Ergebnis

    Das bemerkenswerteste an dieser Studie ist aus unserer Sicht nicht so sehr das Ergebnis, welches gerade die psychologischen Effekte einer QUANTEC®-Behandlung beleuchtet, als die Tatsache, dass hier zum ersten Mal eine Universitätsklinik es der Mühe für wert befunden hat, überhaupt eine Studie mit einem Gerät wie QUANTEC® durchzuführen.
    Das Ergebnis selbst war in der Primäranalyse nicht signifikant, …

  240. #245 Joseph Kuhn
    19. Juni 2012

    @ Ponder: Im Mail von Herrn Schmidt könnte man vieles kommentieren, z.B. gibt es Formulierungen, die zeigen, dass manche Kritikpunkte zwischen Schmidt und Walach tatsächlich diskutiert wurden. Aber jede vielleicht intern dabei gewonnene Einsicht wird im immer gleichen Verteidigungssermon untergepflügt. Manipulativ ist, wie Kritik, Zensur, Pluralismus und fair play zusammengebracht werden, verbunden mit dem Hinweis, dass ich, sicher gegen mein Interesse, “pluralismuseinschränkende Kräfte” stärken würde. Wenn “Pluralismus” nur als Chiffre für “Jeder macht, was er will und so gut er´s kann” dient, liegt die Stärkung dieser Kräfte völlig in meinem Interesse, dann geht es nämlich um Fragen der wissenschaftlichen Qualität und Integrität, nicht um “fair play”, bei dem jeder mal an den Fleischtrog darf. Das scheint die Hochschulstrukturkommission verstanden zu haben. Insgesamt, wie gesagt, nichts Neues, daher will ich mich nicht näher damit beschäftigen.

  241. #246 Ponder
    22. Juni 2012

    nichts Neues, daher will ich mich nicht näher damit beschäftigen.

    Etwas Neues und Interessantes gibts aber per PM bei uns ;-)

  242. #248 rolak
    22. Juni 2012

    hmmmm, das dürfte dann für jeden echten VTler wie Weihnachten und Ostern an einem Tag sein…

  243. #249 ZetaOri
    22. Juni 2012

    @rolak· 22.06.12 · 16:38 Uhr

    hmmmm, das dürfte dann für jeden echten VTler wie Weihnachten und Ostern an einem Tag sein…

    Hmm, … für die dort beschäftgten Esos dürfte es eher wie ‘Karfreitag’ und ‘Volkstrauertag’ an einem Tag sein.

  244. #250 Dr. Webbaer
    22. Juni 2012

    Da finden sich. wie Bullet schon angemerkt hat, zurzeit köstliche Artikel:
    ‘Institutsleiter Harald Walach reagierte auf mehrfache Anfragen nicht.’
    http://www.spiegel.de/unispiegel/wunderbar/uni-viadrina-komplementaermedizin-droht-das-aus-a-839999.html
    ‘Eine Fortführung des Instituts für transkulturelle Gesundheitswissenschaften ist weder wie bisher als In-Institut noch als An-Institut zu befürworten.’

  245. #251 kermit
    22. Juni 2012

    In der gesamten Diskussionsrunde scheint niemandem richtig klar zu sein, dass unser gesamtes gesellschaftliches Leben auf esoterischen Ansätzen beruht, falls man bereit ist, alle Religionen in diesen Topf zu werfen (bitte nicht auf die unterschiedlichen Definitionen hinweisen, ich weiß…).Wie würden wir wohl reagieren, wenn wir nie etwas vom Christentum (oder anderem) gehört hätten und aufgefordert werden, zu beten…? Die entsprechenden Studiengänge werden übrigens staatlicherseits massiv finanziell unterstützt und viele der hier diskutierenden bekennen sich wohl auch zu dieser Praxis ….. von der noch niemand eine positive Wirkung mit wissenschaftlichen Methoden nachweisen konnte.Worüber also regt man sich hier auf?

  246. #252 rolak
    22. Juni 2012

    Weißte, ZetaOri, ich wollte ja nur mal einen positiven Aspekt herausstellen, der mir bzgl einer möglichen Institutsschließung bisher noch nicht eingefallen war.

    Dann scheint jemand unbedingt seine Fähigkeiten als Schnellmerker betonen zu müssen…

    Und eine Praxis, zu der ich mich bekenne, kermit, ist die meines Hausarztes. …wo sind bloß die Störche hin?

  247. #253 Joseph Kuhn
    22. Juni 2012

    @ kermit:

    “dass unser gesamtes gesellschaftliches Leben auf esoterischen Ansätzen beruht, falls man bereit ist, alle Religionen in diesen Topf zu werfen”

    Deswegen sollte man auch nicht alles in einen Topf werfen. Dabei kommt meistens nichts Gutes heraus und man ist schnell bei denen, die sagen, dass irgendwie alles mit allem zusammenhängt.

    @ Dr. Webbär:

    ” ‘Institutsleiter Harald Walach reagierte auf mehrfache Anfragen nicht.’ “

    Seltsam, weil das INTRAG ja in den letzten Tagen eine regelrechte Kommunikationsoffensive gestartet hat, man lese nur nach, was Andreas Giesen vom INTRAG alles auf Esowatch geschrieben hat (www.esowatch.com, da gibt es einmal einen Blog und einmal ein Forum, warum auch immer, auf beidem hat Herr Giesen viel geschrieben).

    Herr Walach hat zudem angeboten, sich mit mir zu treffen. Ich will mich aber nicht mit ihm treffen, weil die Sachargumente zur Masterarbeit hinreichend ausgetauscht sind und wir in der Bewertung der Qualität der Masterarbeit nach wie vor völlig unterschiedliche Positionen vertreten.

  248. #254 Ponder
    25. Juni 2012

    @ all:

    Weil bei EW drüben grad umgebaut wird, poste ich ein paar neue Infos der Einfachheit halber hier.

    Unterstützt wird der CAM-Studiengang u.a. auch durch eigenartige Stiftungen:

    http://www.sirius-stiftung.org/Frameset/projekte.html

    http://www.chiron-concept.eu/frameset_neu/bewusstsein.html

    http://www.chiron-concept.eu/frameset_neu/index2.html

  249. #255 Ponder
    25. Juni 2012

    Weiter:

    Diese Verbindung ist derzeit auch (noch) auf den Seiten des IntraG zu finden:

    IntraG

    Vernetzung

    Zu den folgenden Organisationen bestehen Kontakte:

    Komplementärmedizinische Evaluationsforschung

    CHIRON Holistic LIFE & HEALTH Concept

    http://www.chiron-concept.eu/frameset_neu/CHIRON_frameset.htm

    http://www.europa-uni.de/de/forschung/institut/institut_intrag/institut/partner/index.html

    Im Hintergrund dieser seltsamen Stiftungen CHIRON und SIRIUS (zumindest CHIRON scheint ein europäisches Konsortium zu sein..) tauchen immer wieder 2 Namen auf:

    © und verantwortlich für den Inhalt:

    CHIRON Holistic LIFE & HEALTH Concept UG (haftungsbeschränkt)
    Geschäftsführer:
    Gabriele Greiner, Wolfgang Ruske
    Seidenweberstr. 35
    D-41189 Mönchengladbach
    Deutschland
    Tel. +49(0)2166.671276
    Fax +49(0)2166.671277
    office @ chiron-concept.org

    Es lohnt sich, dem mal nachzugehen – Erstaunliches tritt ans Licht!

  250. #256 G.W.
    26. Juni 2012

    @Ponder

    Danke für die Hinweise. Ich habe mir einige der Seiten angeschaut (sonst pflege ich so etwas zu vermeiden, ich kann meine Zeit anders verschwenden). M.E. handelt es sich letztlich um pseudoreligiös überwölbte Wellness vorzugsweise für ein betuchtes Publikum, dem sein eher profanes Seelenheil am ziemlich materialen Herzen nahe dem Buffet liegt. Kostproben, die mir auffielen (viele Seiten enthalten ja keine Angaben):
    Infrarotanalytik
    „In einer Behandlung testete Dr. med. K.-P. Schlebusch eine Infrarotkamera und bekam dabei Ergebnisse, die mit der Realität (sic) nicht vereinbar waren. So wurden Stellen am menschlichen Körper gezeigt, mit ca. 18 °C und direkt daneben liegende Stellen mit über 50 °C. Der Hersteller bestätigte, dass die Kamera einwandfrei funktionierte.“ Natürlich dürfen da die Biophotonen nicht fehlen.
    „Parallel zu der Arbeit in der Praxis wurde der Hintergrund für die Ergebnisse mit dem namhaften Physiker Prof. Fritz-Albert Popp erforscht. Dieser stellte bereits 1975 unmissverständlich heraus, dass alle lebenden Substanzen Biophotonen zwischen 200 und 800 Nanometern ausstrahlen. ……………. Die ultraschwache Zellstrahlung gilt heute als unumstritten, jedoch ist man sich nicht über ihre Herkunft und Funktion einig.“

    Farbtherapie (Farbpunktur)
    „Das Biophotonenfeld hat im gesunden Zustand durch seine hohe Kohärenz (Bündelung der Strah¬lung wie beim Laserlicht) die Fähigkeit, auf alle Störungen und Einflüsse flexibel zu antworten und sie auszugleichen. Es pendelt dabei ständig zwischen zwei Zuständen hin und her, die der “Vater der Biophotonentheorie”, Fritz Popp, selbst schon mit dem chinesischen Yin und Yang verglichen hat.“ Schon sind wir wieder beim Quantenwahn der makroskopischen Kohärenz und Verschränkung, für den nichts und gegen den alles spricht, was aus der physikalischen Forschung bekannt ist.
    „In diesem Zusammenhang gewinnen die Forschungsarbeiten des Instituts für Klinische und Expe¬rimentelle Medizin in Nowosibirsk, besondere Bedeutung. Ein Forscherteam unter Leitung von Prof. Kaznachejew (Gruber 1989) konnte in mehrjähriger Arbeit nachweisen, daß es im menschli¬chen Körper Leitungsbahnen für Licht gibt, die exakt dem Verlauf der Meridi¬ane in der traditio¬nellen chinesi¬schen Medizin entsprechen.“ Das geht auch in Richtung „Lichtnahrung“.
    Wie man als jemand mit universitärem, akademischem Anspruch (cogitare est distinguere) in diesen Universalsumpf waten oder sich hineinziehen lassen kann, in dem alles mit allem irgendwie irgendwo irgendwann zusammenhängt, alles zu allem irgendwie irgendwo irgendwann passt, alles mit allem irgendwie irgendwo irgendwann therapiert oder sonst irgendwied werden kann usw., ist mir unverständlich. Wenn das irgendwie irgendwo irgendwann die wissenschaftlichen Revolutionen sind, die uns irgendwie irgendwo irgendwann in Analogie zu Kepler, Galilei usw. beschieden sind, dann müssen wir das wohl irgendwie irgendwo irgendwann erwarten und dann irgendwie irgendwo irgendwann Ressourcen hineinstecken, die dann präzise woanders und nicht irgendwie irgendwo irgendwann fehlen.

  251. #257 Aiko
    29. Juni 2012
  252. #258 Daniel Elstner
    29. Juni 2012

    @Aiko: Warten wir es ab. Ich habe ein paar Web-DNS-Queries außerhalb Deutschlands probiert, und die lösen für http://www.esowatch.com momentan auch nach 127.0.0.1 auf. Daher erscheint mir eine “Sperrung der Domain http://www.esowatch.com im deutschen DNS-System” als Ursache doch eher unwahrscheinlich.

    Was immer MMNews sein soll — der Tonfall hört sich nach der typischen Klientel an, die sich von Esowatch auf den Schlips getreten fühlt.

  253. #259 Aiko
    29. Juni 2012

    @ Daniel Elstner: Danke.

    OMG :-))

    Ich werd’ jetzt Mitglied von GWUP.

    MMnews gehört zu http://www.mross.de/

  254. #260 rolak
    29. Juni 2012

    und verlinkt unter dem weiter obern verlinkten Beitrag einen Text vom hinlänglich bekannten Brachialhomöopathen Fritsche.
    /GWUP++/ gute Idee, Aiko.

    Bis heute früh morgens funktionierte noch die nebenan ausgeführte Umleitung. Im Zuge der Reparaturmaßnahmen scheint allerdings ein wenig verschlimmbessert worden zu sein — und für 127.0.0.1 benötige ich kein www, da richte ich schlicht den Blick nach links unten :-)
    Mein ‘Hausforum’ war mal fast einen ganzen Monat, gefühlt ein Jahrzehnt wegen eines ähnlichen DNS-Schadens unerreichbar, bis es letztendlich mit dem geretteten backup bei einem neuen Hoster eingerichtet wurde. Also vor der Hand nichts Weltbewegendes. Geht ja auch keiner schon mal Kränze bestellen, wenn zB J.Lopez einige Zeit keinen Sermon abläßt – doch angesichts der Hoffnungslosigkeit bei einer rationalen Betrachtung der vertretenen Thesen scheinen gewisse Kreise, bevor sonst nichts bleibt, lieber Nichtgeburtstag zu feiern.

    Ist imho übrigens erstaunlich, wie sehr sich gewisse sach-, fach- und realitätsfremde Txte ähneln, zu ‘renommiert’ siehe auch nebenan.

  255. #261 Joseph Kuhn
    30. Juni 2012

    Etwas OT, aber vielleicht von Interesse: Heute ist in der Süddeutschen ein langer Artikel von Jens Lubbadeh: “Die schmutzigen Methoden der sanften Medizin. Wie die Homoöpathie-Lobby mit Kritik umgeht.” Im Wesentlichen setzt sich Lubbadeh mit den Internetseiten von Claus Fritzsche und der Finanzierung durch Pharmafirmen aus dem Umfeld der Homöopathie sowie dem DZVhÄ auseinander.

  256. #262 rolak
    30. Juni 2012

    Für den Fall der Fälle bitte nicht wegwerfen, Joseph – den Artikel werde ich nachher im nichtsüddeutschen Raum versuchen zu erstehen (was jedoch kein Problem darstellen sollte). Erinnert mich nach Deiner Kurzbeschreibung an den von vor fünf Monden. Und über das dortige Auftauchen des Namens ‘Walach’ ist doch alles wieder hübsch mit dem Thema verbunden. Noch kein ‘alles mit allem’, aber immerhin ;-)

  257. #263 rolak
    30. Juni 2012

    So kann das Leben spielen — da wandere ich stunden- wenn nicht gar minutenlang durch Köln zum Kiosk umme Ecke, ergttere so eben noch das fast letzte Exemplar von dem knapp meterhohen Stapel, nur um bei der schon fast reflexhaften Suche im Netz festzstellen, daß der Artikel schon eingestellt wurde^^ (oben, unten). Der scan ein bißchen fleckig, doch angesichts der bei hinreichend Skrupellosigkeit sich eröffnenden Verdienstmöglichkeiten können einem schon die Tränen kommen.
    Was ein Glück für neugierige NichtSzBesitzer…

    Wie üblich bei spaltigen Texten zum geschmeidigen Lesen am besten beide Teile parallel in zwei Tabs öffnen.

  258. #264 Joseph Kuhn
    30. Juni 2012

    @ rolak: Noch geschmeidiger liest es sich direkt bei der SZ, der Artikel ist jetzt online:
    http://www.sueddeutsche.de/wissen/homoeopathie-lobby-im-netz-schmutzige-methoden-der-sanften-medizin-1.1397617

  259. #265 rolak
    30. Juni 2012

    Allerdings, Joseph, deutlich angnehmer. Jetzt. Doch wer kennt schon den genauen Algorithmus für die Abbildung Papier=>www…

  260. #266 Stefan W.
    30. Juni 2012

    Etwas offtopic: Beim Humanistischen Pressedienst http://hpd.de/node/13653 lese ich in einem Nebensatz:

    Achtzig Jahre nach der „deutschen“ Physik und 35 Jahre nach dem „Binnenkonsens“ für eine „deutsche“ Medizin in Form der Homöopathie und der anthroposophischen Medizin: Es gibt Anzeichen dafür, …

    dass die Homöopathie als “deutsche Medizin” bezeichnet wird.

    Dazu habe ich 2 Fragen:
    a) Ist die Popularität von Homöopathie auf den deutschen oder deutschsprachigen Raum beschränkt? Gibt es in Italien, Frankreich, England beispielsweise keine oder so gut wie keine Homöopathie, verglichen mit Deutschland (Österreich, Schweiz).

    b) Gibt es von namhaften Apologeten, insbesondere dem Erfinder der Homöopathie Zeugnisse, die eine Wirksamkeit nur für Deutsche behauptet, oder eine exklusive Besetzung der Medizinmannpositionen, oder was würde die Bezeichnung rechtfertigen?

    Was die Physik betrifft, so ist mir bekannt, dass zur NS-Zeit Einstein als wider eine deutsche Physik, die dann an ihrer Idiotie erstickt ist, verunglimpft wurde. Von NGM (Neue Germanische Medizin) habe ich auch gehört, aber nicht, dass diese mit dem Antroposophentum oder mit Hahnemann so eng verzahnt wären, als dass man die alle über den gleichen Kamm scheren könnte.

    Weiß dazu wer mehr?

  261. #267 Joseph Kuhn
    30. Juni 2012

    @ Stefan W.:

    Zur zweiten Frage weiß ich gar nichts, zur ersten kann ich auch nur mit einem Auszug aus dem Wikipedia-Eintrag zu “Homöopathie” dienen. Da steht:

    “Heute ist die Homöopathie in fast allen Ländern der Erde vertreten. Weltweit liegt der Umsatz mit homöopathischen Arzneimitteln geschätzt in einer Größenordnung von 2 Milliarden Euro. Das sind weniger als ein Prozent des gesamten Arzneimittelmarkts. Die größten Märkte sind Frankreich, USA, Deutschland und Indien. Die Hälfte des Homöopathie-Marktes entfällt auf Europa.
    In Großbritannien forderte ein Ausschuss des Unterhauses Anfang 2010 aufgrund fehlender Wirkungsnachweise, Homöopathie nicht mehr mit öffentlichen Mitteln zu finanzieren. Trotz der Empfehlungen des Ausschusses hat die Regierung Großbritanniens beschlossen, die Homöopathie weiterhin über das NHS bezahlen zu lassen. Sie stimmt zwar weitgehend mit den Einschätzungen des Ausschusses überein, glaubt aber, dass der informierte Patient und sein Arzt in der Lage seien, die geeignete Behandlung zu finden. Dies schließe auch eine alternative Methode wie die Homöopathie ein.”

  262. #268 ZetaOri
    30. Juni 2012

    @Stefan W.· 30.06.12 · 20:54 Uhr

    [...]
    a) Ist die Popularität von Homöopathie auf den deutschen oder deutschsprachigen Raum beschränkt? Gibt es in Italien, Frankreich, England beispielsweise keine oder so gut wie keine Homöopathie, verglichen mit Deutschland (Österreich, Schweiz).
    b) Gibt es von namhaften Apologeten, insbesondere dem Erfinder der Homöopathie Zeugnisse, die eine Wirksamkeit nur für Deutsche behauptet, oder eine exklusive Besetzung der Medizinmannpositionen, oder was würde die Bezeichnung rechtfertigen?
    Was die Physik betrifft, so ist mir bekannt, dass zur NS-Zeit Einstein als wider eine deutsche Physik, die dann an ihrer Idiotie erstickt ist, verunglimpft wurde. [...]

    Nun ja, die “Deutsche Physik” sollte ja auch nicht nur für Deutsche wirken. Und zumindest hat die H. zur selben Zeit in D. ihre Hochblüte erlebt und sollte zusammen u.a. mit dem anthroposophischen Quack ein Standbein der “Neuen Deutschen Heilkunde” werden, ist aber sogar da “an ihrer Idiotie erstickt”. (siehe Links zum “Donner-Report” im Wiki)
    Aber: Nein, Dummheit ist nicht genuin deutsch, der Blödsinn hat sich schon zu Zeiten des seligen Samuel weltweit verbreitet!

  263. #269 Basilius
    1. Juli 2012

    Mist!
    Zu langsam. Gerade den Artikel da drüben verlinkt und dann drauf gekommen, daß der hier auch gut…
    …aber zu langsam.
    Egal, Hauptsache die Informationen werden weitergetragen.
    ^_^

  264. #270 Ponder
    1. Juli 2012

    @ all:

    Damit die für diesen Faden relevanten Informationen auch schnell und problemlos zu finden sind – voila:

    https://nonamewatch.wordpress.com/2012/06/30/institut-fur-transkulturelle-gesundheitswissenschaften-der-europa-universitat-viadrina/
    ;-)

  265. #271 Joseph Kuhn
    1. Juli 2012

    @ Basilius: In der Tat, zu langsam. rolak hatte den Artikel mit großem Selbstfortbewegungseinsatz hier schon gestern online gestellt, siehe oben. Aber er ist immer schneller, vermute den heimlichen Einsatz eines Kozyrev-Spiegels.

  266. #272 rolak
    1. Juli 2012

    Boah wie gemein, wenn die Tricks verraten werden — na egal, nehme ich das Teil halt wieder auseinander (paßt auch gut, die Alufolie ist beim aktuellen Wetter dringend nötig zum Grillen) und statt durch die bzw in die Röhre zu schauen belege ich ein, zwei Kurse. Danach wird euch aber sowas von Hören und Sehen vergehen…

    Es sei denn, ich wär zu doof dafür.

  267. #273 Stefan W.
    1. Juli 2012

    Danke, Joseph Kuhn, Zeta Ori und Basilius.

  268. #274 Basilius
    1. Juli 2012

    @Stefan W.
    Danke für die Blumen.
    ^_^

  269. #275 Ponder
    7. Juli 2012

    @ all:

    Gute Nachrichten:

    EsoWatch heißt jetzt Psiram
    7. Juli 2012

    Sooo, Lazarus ist aus seinem Grab geklettert. Es hat etwas länger als drei Tage gedauert und er ist noch etwas staubig, aber er ist wieder da.

    Vor einiger Zeit beschlossen wir, mit unserem Verbraucherschutzportal auf andere Server umzuziehen. Oft gehen solche Veränderungen nicht reibungslos über die Bühne und auch wir blieben von ein paar Pannen, Missverständnissen und Problemen nicht verschont. Und es war/ist sogar ein wenig amüsant, die entstehenden Verschwörungstheorien zu lesen. Wir hätten uns gewünscht, dass alles etwas glatter geht, aber C’est la vie.

    Wir haben uns entschieden, den Umzug gleich zu nutzen, um unseren Namen mehr an unsere Themen anzupassen. Das Problem war, dass der Begriff EsoWatch nicht sehr treffend war. Sicher, Esoterik ist ein wichtiger Teil unseres Spektrums, aber auch Pseudowissenschaft, Irrationale Überzeugungssysteme, Alternative Medizin und vieles mehr. Immer wieder wurden wir gefragt: “Was hat das mit Esoterik zu tun?”
    Allerdings gestaltete sich die Wahl eines neuen Namens relativ schwierig. Viele Ideen standen zur Diskussion und wurden wieder verworfen, andere *Watch-Varianten, sowie diverse Kombinationen passender Begriffe waren im Gespräch.
    Am Ende entschieden wir uns für einen begriffsneutralen Namen. Wofür wir stehen, erklärt der Text auf unserer Homepage.

    Wir hoffen, dass unsere Leser uns erhalten bleiben und sich schnell auf den neuen Namen einstellen. Ihr könnt uns jetzt auf unserem neuen Twitteraccount folgen, den alten wir werden nach und nach aufgeben.

    Bitte verbreitet das weiter, gerne als Voll- oder Teilzitat dieses Textes.

    http://blog.psiram.com/2012/07/esowatch-heist-jetzt-psiram/

  270. #276 rolak
    7. Juli 2012

    Ist das wie mit Raider & Twix? Nu, ich erlaubte mir mit einem schnellen grep() nur die urls in den bookmarks, allerdings nicht die Namen zu ändern :p

    amüsant, die entstehenden Verschwörungstheorien zu lesen

    Wohl wahr, kann ich mit Inbrunst bestätigen und dies ist auch der einzig negative Aspekt bei der Phönixisierung.
    Doch selbst aus offen einsehbaren Küchen drangen schon dämpfende Gerüchte.

    länger als drei Tage

    Och, das ist relativ. Bei mir zu Hause ist immer noch Dämmerung, und ich kann Dir sagen: *Was*für*ein*Sonnenaufgang*…

  271. #277 noch'n Flo
    7. Juli 2012

    Schade nur, dass auf der alten EsoWatch-Seite kein Verweis auf die neue Domain ist (bzw. die alte Addy gar nicht mehr funktioniert). Ich habe die Adresse schon oft weitergegeben – viele Leute werden die neue Seite leider nicht mehr finden, weil sie nicht unbedingt regelmässig in skeptischen Foren verkehren.

  272. #278 Aiko
    7. Juli 2012

    https://nonamewatch.wordpress.com/
    Weiß jemand darüber etwas Näheres?

  273. #279 rolak
    8. Juli 2012

    Ja, Aiko: Hatte Ponder hier auf SB(D) als zwischenzeitlichen Notbehelf verlinkt.

    Hi Ponder, der Umzug scheint glatt gelaufen zu sein, insbesondere traf meine (ungemein naheliegende) Vermutung zu, daß bei Wechsel der base-url alle bookmarks und links funktional bleiben. Erfreulicherweise sind auch die nick/pw-Päärchen für wiki+Forum noch benutzbar. Ein einziger Wermutstropfen bei Letzterem ist die soeben in Alarmrot erschienene ?B?r?i?e?f? pm-Wechsel-Fortsetzungs-Abschmetterung

    Der Benutzer ‘Ponder‘ kann keine Privaten Mitteilungen empfangen.

    (<Name> von der Redaktion angepasst) Falls das an gewisser Leute Forumseinstellung liegen sollte – den Text habe ich mir vorsichtshalber für einen erneuten Versuch gesichert.

  274. #280 Ponder
    8. Juli 2012

    @rolak:

    Das mit den PMs scheint generell noch nicht zu klappen, siehe den Thread Anregungen/ Verbesserungen.
    Ich hoffe, das hat sich bis nach meinem Urlaub eingespielt. :)

    Falls du mir etwas Dringendes mitteilen wolltest, ginge das notfalls auch über Info at psiram…

  275. #281 rolak
    8. Juli 2012

    Soso, also nicht die Ein-, sondern die Umstellung – na dann warte ich ebenfalls ein wenig ab, dringend wars nämlich in keiner Weise. Angenehmen Urlaub, Ponder!

  276. #282 Ponder
    8. Juli 2012

    @ rolak:

    Probiers einfach zeitnah noch mal ;-)
    Mir scheint, es ist grad am Werden.

  277. #283 Aiko
    8. Juli 2012

    Ich hab’ da jetzt eine ganz andere Frage, die leider nicht zum Blogthema passt, aber ich weiß jetzt auch nicht, wem ich sie sonst stellen könnte.
    Ich hatte auf EsoWatch nach AMSAT-HC zu suchen versucht und dabei eben entdeckt, dass die Seite futsch war. Im Netz gibt es nichts Kritisches zu diesem Diagnose-Quatsch und ich möchte da einer Bekannten helfen, aus einer Sache heraus zu kommen. Dafür brauche ich ein paar sinnvolle Argumente.
    http://www.amsat-hc.de/
    Wisst ihr Näheres darüber?

    Danke.

  278. #284 Ponder
    8. Juli 2012
  279. #285 Aiko
    8. Juli 2012

    DANKE ……. Ponder.

    :-))))))))))

  280. #286 Joseph Kuhn
    8. Juli 2012

    Zum Blogthema gibt es etwas nachzutragen, schon Ende Juni war in PNN – Potsdamer Neueste Nachrichten – ein Beitrag zur drohenden Institutsschließung: http://www.pnn.de/brandenburg-berlin/659626/

    Zwei Sätze aus dem Artikel:

    “Zum Fortbestand des Instituts gebe es im Ministerium noch keine abschließende Position, heißt es auf PNN-Nachfrage.”

    Und Herr Pleuger, der Präsident der Viadrina, wird in den PNN mit folgenden Worten zitiert:

    „Die Europa-Universität Viadrina Frankfurt (Oder) nimmt die Empfehlung der Brandenburgischen Hochschulstrukturkommission zur Schließung des Instituts für transkulturelle Gesundheitswissenschaften und des daran geknüpften Studiengangs zur Kenntnis“

  281. #287 Thilo
    9. Juli 2012

    Hmm, im neuen PNN-Artikel wird Walach zur Hellseher-Arbeit nun so zitiert:

    Für den Berliner Studierenden zumindest hätte das Aus des Instituts wohl keine weiteren Folgen. Er hat mit seiner Abschlussarbeit bestanden. „Die Form war nicht so wahnsinnig gut, aber Zensuren nenne ich nicht“, sagt Professor Walach.

    Das erweckt den Eindruck, dass der Student zwar bestanden habe, aber wohl mit einer schlechten Note. Jedenfalls wird der uninformierte Leser dies annehmen. Vor ein paar Monaten (ich finde jetzt die Quelle nicht mehr) war die Arbeit von Walach noch als eine der besten des Jahrgangs ausdruecklich hervorgehoben worden – damals hoerte es sich nicht so an, als habe der Student eine schlechte Note bekommen und vermutlich hat er das auch tatsaechlich nicht (spekuliere ich mal).

    Man hat den Eindruck, dass Walach Leute immer dann fallen laesst, wenn es fuer ihn unangenehm zu werden droht. Auf der Webseite des IntraG ist seit einigen Tagen eine Erklaerung Walachs, mit der er sich von Harry van der Zee und der Amma-Foundation distanziert und erklaert, mit deren Forschung nie zu tun gehabt zu haben. Auch von Hartmut Mueller distanziert er sich ja, seit dieser vor Gericht steht, sehr deutlich, inzwischen verklagt er jeden, der behauptet, es sei eine Zusammenarbeit des IntraG mit Hartmut Mueller geplant gewesen.

    Ich bin ja gespannt, wie lange es noch dauert, bis Walach sich auch von Hartmut Schroeder, Gregor Nickel, Claus Fritsche … etc.pp. distanziert und angibt, mit diesen nie etwas zu tun gehabt haben zu wollen :-)

  282. #288 Joseph Kuhn
    9. Juli 2012

    @ Thilo: Die Masterarbeit wurde von den Betreuern als “hervorragende” Arbeit gewürdigt. Nun ragt zwar auch der Stein des Anstoßes hervor, aber so war das wohl nicht gemeint.

    Nur am Rande zur aktuellen Erklärung von Herrn Walach: Da steht, der Erfinder des Arzneimittels PC1, Peter Chappell, “(…) hat z.B. die elektromagnetischen Geldkarten seinerzeit erfunden und ist der Meinung, man könne homöopathische ‘Information’ mit elektromagnetischen Methoden ‘übertragen.’ ” Offensichtlich einer von vielen Fällen der Elektrifizierung esoterischer Methoden.

    Was die von Herrn Walach genannte “Amma Resonance Healing Foundation” angeht, liest man am besten selbst: http://www.arhf.nl/index.php

  283. #289 Thilo
    9. Juli 2012

    Was ist eigentlich dran an der Behauptung, Chappell sei der Erfinder der elektromagnetischen Geldkarten? Gibt es dafür Quellen?

  284. #290 rolak
    9. Juli 2012

    a) ‘elektromagnetische Geldkarte’ ist ein Oxymoron. Geldkarte ist der Name für den Chip der EC-Karte, bzw allgemein jede zum PIN- und kontozugriffs-losen Zahlen genutzte Kombination Plastik+Chip. Die Chipkarte an sich wurde afaik ’67 von einem gewissen J.Dethloff patentiert.
    b) Die Geschichte der EC-Karte liegt komplett in meinem Leben: 1969 eingeführt in der Bedeutung ‘euro-cheque’, Anfang der 80er kam der Magnetstreifen, Anfang der 90er die Umdeutung zu ‘electronic-cash’ und die ersten mit Geldkarten-Funktion. Bei aller Abgehobenheit der Führungsebenen der großen Banken – ich kann mir nicht vorstellen, daß die einen Homöopathen und Möchtegernpsychiater herangezogen haben, um dieses System zu entwickeln. Age of Aquarius hin oder her…
    Und das Prinzip Magnetaufzeichnung ist meineserachtens deutlich zu alt, um von einem noch aktiven Menschen erfunden worden zu sein.
    Doch sein Profil läßt sich ja auch dahingehend deuten, daß er der Vater der Textverarbeitung ist :-)

  285. #291 Joseph Kuhn
    10. Juli 2012

    @ rolak:

    “Doch sein Profil läßt sich ja auch dahingehend deuten, daß er der Vater der Textverarbeitung ist”

    Darüber ist der gute Mann vermutlich längst hinaus. Schließlich hat er ein Allheilmittel gegen AIDS gefunden. Allerdings: “I decided to keep the details of how this is done a secret. The basic idea aligns to the work of Tesla and quantum resonance theories.” Und das funktioniert nicht nur bei AIDS, nein, bei allen Krankheiten: “The same process I used to design PC1 for AIDS can be used for all diseases”.

    Bei Herrn Walach scheint das, ganz ähnlich wie beim Kozyrev-Spiegel, nicht den Impuls ausgelöst zu haben, die Hände über dem Kopf zusammenzuschlagen, sondern die Sache interessant zu finden. Er schreibt in der von Thilo erwähnten neuen Stellungnahme über das Wundermittel PC1: “Ich kenne nur klinische Erfahrungsberichte, die ich interessant fand. Es war nicht meine Absicht, dieses Medikament zu bewerben, sondern allenfalls es zu beforschen. Letzteres ist wie gesagt nicht möglich, und daher habe ich mich damals zurückgezogen.”

    Forschung ist wohl auch nicht mehr nötig, schreibt doch sein verschmähter Partner Chappell: “For the first time in my life I realised that a remedy always works, and if it does not seem to, then there is always an explanation like wrong diagnosis, starvation or continuous reinfection. Later I discovered that the AIDS resonance PC1 did not work well in the west, but that’s another story with a valid, understandable explanation, and an issue I’m working on.”

    Nun denn.

  286. #292 noch'n Flo
    10. Juli 2012

    Dieser Peter Chappell ist ja ein echtes Genie. Bei Psiram findet man folgende Entdeckungen von ihm:

    Für folgende Infektionskrankungen und Zustände bietet Chappell Mittel an:

    AIDS (als “AIDS Vaccine”)
    Bilharziose
    kindliche Durchfälle in afrikanischen Ländern
    Malaria
    Lepra
    Folgen und Traumen einer Vergewaltigung (PC435p for effects of rape)
    Gegen Nebenwirkungen der effektiven AIDS-Therapie HAART (PC501h for side-effects of HAART)
    Folgen von Atombombenabwürfen
    Schlangenbisse
    Elektrosmog durch Mobiltelefone
    Bettnässen
    Pornographie
    religiöser Fanatismus

    ( http://www.psiram.com/ge/index.php/Peter_Chappell )

    Hmmm, Pornographie ist also wahlweise eine Infektionskrankheit oder ein Zustand…

  287. #293 noch'n Flo
    10. Juli 2012

    Hoppla, der letzte Satz sollte eigentlich nicht mehr ins Blockquote.

  288. #294 noch'n Flo
    10. Juli 2012

    @ Aiko:

    Ach ja, bevor ich es vergesse: vielen Dank dafür, dass Du uns auf “AMSAT” aufmerksam gemacht hast. Nachdem ich Ponders Link zu Psiram angeklickt hatte, bekam ich erst einmal einen gepflegten Lachkrampf: http://psiram.com/ge/index.php/Datei:AMSAT-HC.jpg – Einfach mal wieder dämlich aussehen, mit unserem Gerät geht das ganz einfach!

  289. #295 Aiko
    10. Juli 2012

    @ noch’n Flo
    Peter Chappell ist halt der John Doe der Forschung.

    Im übrigen, wenn man bedenkt, dass einmal Lachen auf dem AMSAT-Pedalen ca. 250 Euro kostet, dann finde ich das irgendwie auch lustig, sofern es nicht mein Geld ist.

    Das Ganze Eso-Medizin-Gedöns funktioniert nur, weil zuviel Geld im Umlauf ist und es irgendwie wenigstens so “entwertet” werden muss.
    Jüngst hat mir ein privatversicherter Bekannter sein Leid geklagt, dass er durch-diagnostiziert wird und nur als Geldquelle dient.
    Dummheit hat eben ihren Preis.

  290. #296 noch'n Flo
    10. Juli 2012

    Hmmm, man könnte doch mal einen Fotowettbewerb veranstalten – wer findet das dämlichste Demonstrationsfoto für Eso-Quatsch?

  291. #297 Dr. Webbaer
    10. Juli 2012

    @Kuhn
    Noch einmal Applaus für diesen Artikel und dessen Wirkung.

    Zum Blogthema gibt es etwas nachzutragen, schon Ende Juni war in PNN – Potsdamer Neueste Nachrichten – ein Beitrag zur drohenden Institutsschließung: http://www.pnn.de/brandenburg-berlin/659626/

    Es sind oft die Kleinigkeiten, die den Reiz solcher Artikel ausmachen – ‘Seine [Walachs] eigene Professur hingegen wird von der Firma Heel aus Baden-Baden gesponsert.’:
    -> http://www.heel.de/
    -> http://www.heel.de/Heel-de-Heel-Deutschland.html?ActiveID=10000284 (Gutes Homäopathisches für Mensch und Tier)

  292. #298 Dr. Webbaer
    10. Juli 2012
  293. #299 Stefan W.
    10. Juli 2012

    @noch’n Flo:

    Ich meine in einem Kernspintomographen sieht man auch nicht viel intelligenter aus, oder mit den Tentakeln für ein EEG auf dem Haupt, mit aufgepolsterten Lippen im Sessel eines Zahnarztes, vor einer Bestrahlungslampe …

    Es ist ein dürftiges, antiaufklärerisches Verfahren von simplen Äußerlichkeiten auf den Wert einer Methode zu schließen, und umgekehrt würde ich eher davon ausgehen, dass sich dieses Bild die typischen Reha- und Diagnostikbilder die auch für echte Medizin gemacht werden zum Vorbild genommen haben.

    Ja – ich weiß, dass Du nicht vom Photo auf den Wert der Methode rückschließt, aber dann tu doch nicht so als ginge das.

  294. #300 Thilo
    10. Juli 2012

    Das laecherliche an dem Foto ist ja gerade, dass es verkrampft und unbedingt ganz genauso aussehen will wie die richtigen Arzt-Fotos.

  295. #301 Joseph Kuhn
    10. Juli 2012

    @ Dr. Webbär: Danke für die Links zu den Firmenbesitzzusammenhängen, interessant angesichts der beliebten Inszenierung einer Gegenüberstellung von Big Pharma und kleinen machtlosen Anbietern von “Alternativmedizin”.

  296. #302 noch'n Flo
    10. Juli 2012

    Tja, der Braunbär weist mal wieder auf das Offensichtliche hin – als ob wir das nicht schon längst wussten.

    Aber trotzdem: *denbärenhintermohrkraulundihmeinleckerligeb*

  297. #303 Dr. Webbaer
    11. Juli 2012

    @Flo
    So-o, wo stand das denn?

    MFG
    Dr. Webbaer (Grizzly, Graubär btw)

  298. #304 rolak
    11. Juli 2012

    wo stand das denn?

    Na im wiki, hast Du doch selber verlinkt. Ist ein offen und für jedermann offen einsehbares Lexikon und damit zeigt Deine ungemein investigative Forschung in sinistren Quellen eben das Offensichtliche. Solltest Du etwa tatsächlich erst zum Zeitpunkt des Kommentars auf die Idee gekommen sein, mal über die wirtschaftlichen Zusammenhänge nachzudenken? Armutszeugnis.

    btt: Das IntraG-Drama sieht ja so aus wie ein peinlicher Ausrutscher einer Clique Abstrusitäten-exaltierter, von der Pharmaindustrie gekaufter PR-Fuzzis. Während die eigentliche, gute Homöopathie ganz anders ist.
    Meine Nachbarin geht wg diverser Krankheiten turnusmäßig zur Apotheke und bringt mir seit einiger Zeit die ganzen dort ausliegenden Heftchen mit, auf daß ich diese bei einer meiner Landfahrten zu einer guten alten Freundin verschiffe, auf daß sie für lange Winterabende oder so einen Riesenhaufen Rätsel verschiedenster Art zu lösen hat (macht sie ungemein gerne). Heute gabs “Gesund durch Homöopathie”, 8 Bögen bestes Papier, 4Farbdruck, zu einem 32-Seitigen Werk geklammert, deklariert als Kundenmagazin der DHU, Auflage nicht angegeben – bei 2 Dutzend je Apotheke wärs eine halbe Million. Nicht etwa eine Einzelaktion, nein, Ausgabe 3/2012…
    Eine gebündelte Werbebotschaft in einer Aufdringlichkeit, daß es selbst hartgesottenen Zeugen(J) Tränen in die Augen treibt und in einer Unverfrorenheit, daß mir noch jetzt der Mund offensteht. Grundtenor: Es mag ja sein, daß die Schulmediziner auch irgendetwas zum Ganzen beitragen, doch das Wesentliche und insbesondere die eigentliche Heilung kommt von uns. War als 150dpi 256Farbscan mit 35MiB etwas zu groß für den schnellen up, also bei einem der üblichen sharehoster: Für Interessenten, blöderweise falsch benamt -02- statt -03-, aber das stört hoffentlich keinen großen Geist ;-)

  299. #305 Aiko
    11. Juli 2012

    Drogendealer. Allerdings auf Placebo-Niveau. Da waren mal ganz andere Sachen im Umlauf

    Das hieß ja mal früher – bevor es zu dm und (ver)Rottman umgelabelt wurde – Drogerie.
    Und da wurde Drogen gehandelt. Da kann man nichts machen – die harten Drogen wurde ja auch von deutschen Chemikern gebaut – Kein Husten mehr dank Heroin -

    http://www.tagesspiegel.de/wissen/drogen-deutschlands-grosser-rauschangriff/6850234.html

  300. #306 Basilius
    11. Juli 2012

    Jou, rolak, besonders perfide in dieser Werbepostille finde ich wieder mal die konsequent verlogene Gleichsetzung der Homöopathie mit der Phytotherapie und somit quasi auch noch gleichzeitig die Vereinnahmung jeglicher sanfter, gesunder, lieblicher Naturheilkunde.
    Immer wieder dieselben Lügengebäude.
    Aber das Blättchen scheint mir schon recht professionell gemacht. Das war nicht billig und wird die Zielgruppe schon ansprechen.
    Eine Bekannte von mir verkauft allerlei Medikamente in der Apotheke. Die ist da schon von Anfang an drauf reingefallen und glaubt voll und ganz an all den Summs. Die macht gar keinen Unterschied zwischen Bach, Schüssler, etc. In klassischer Esoterikertoleranz wird von ihr praktisch alles, was man kaufen kann geglaubt. Ich mag gar nicht dran denken, weil ich jedes mal fast verzweifeln möchte an ihr. Aber an diesem Typ Mensch beißen sich solcherlei Propagandafetzen ordentlich fest.

  301. #307 Dr. Webbaer
    12. Juli 2012

    @rolak (slw. ugs. für ‘Rollkragenpullover)

    wo stand das denn? (Dr. Webbaer)

    Na im wiki, hast Du doch selber verlinkt. Ist ein offen und für jedermann offen einsehbares Lexikon und damit zeigt Deine ungemein investigative Forschung in sinistren Quellen eben das Offensichtliche. Solltest Du etwa tatsächlich erst zum Zeitpunkt des Kommentars auf die Idee gekommen sein, mal über die wirtschaftlichen Zusammenhänge nachzudenken? Armutszeugnis.

    Sie schaffen es nicht einmal bei einem Thema, zu dem man fast deckungsgleicher Meinung ist, freundlich zu bleiben.

    Halten wir einfach fest: Es lag eine kommentarisch brauchbare Ergänzung kombiniert mit einem Lob vor; zudem wurde noch ein wenig “gegrillt”, so ein kommentarisches gemeinsames Grillen ist nicht unüblich im Web, wenn eine besondere Leistung [1] (auch: auf Kosten anderer) erbracht worden ist.

    MFG
    Dr. Webbaer

    [1] ja-a, der Schreiber dieser Zeilen ist sich darüber im Klaren, dass nicht nur Herr Dr. Kuhn diesen Topic bearbeitet hat

  302. #308 Joseph Kuhn
    20. Juli 2012

    Das “Laborjournal” berichtet in seiner aktuellen Ausgabe (7-8/2012) unter der Überschrift “Hokuspokus an der Oder” auch noch einmal über die Masterarbeit zum Kozyrev-Spiegel. Neue Informationen gibt es allerdings nicht.

  303. #309 rolak
    20. Juli 2012

    ~ nix Neues

    Unabhängig davon einen frühwochenendlichen Dank für die unermüdlichen Updates via Kommentar.

  304. #310 Joseph Kuhn
    4. August 2012

    Update:

    Der “Material-Dienst” 7/2012 der Evangelischen Zentralstelle für Weltanschauungsfragen berichtet über die Masterarbeit: http://www.ekd.de/ezw/Publikationen_2728.php

    Schon vor drei Wochen hatte der Berliner Tagesspiegel ebenfalls einen Beitrag zum Thema: http://www.tagesspiegel.de/berlin/grenze-der-wissenschaft/6879752.html

    Neue Informationen enthalten die Mediennachzügler nicht.

  305. #311 para
    4. August 2012

    Aus dem ersten Link

    Einer der 35 Absolventen (…) hat in seiner Masterarbeit in einer Pilot-Studie den statistisch signifikanten Nachweis erbracht, dass mithilfe eines sogenannten „Kozyrev-Spiegels“ telepathische Effekte erzielt werden können.

    … irgendwie hätte ich ja erwartet das gerade kirchennahe Artikel umso kritischer ausfallen.

  306. #312 ZetaOri
    4. August 2012

    @Joseph Kuhn· 04.08.12 · 07:47 Uhr

    Update:
    [...]
    Neue Informationen enthalten die Mediennachzügler nicht.

    Was neu ist: Die Akkreditierung des KWKM-Studienganges durch die AHPGS hat es endlich auch in die Datenbank des AK und des HK geschafft. Das PDF auf der Seite der AHPGS wurde ausgetauscht.
    Änderung:
    Altes PDF vom 19.06.2012 11:48:13

    Auflagen
    Die Auflagen wurden in der Sitzung der Akkreditierungskommission vom 16.02.2012 als teilweise erfüllt bewertet. Ausstehend ist:
    - Die überarbeitete Studien- und Prüfungsordnung ist nach der Genehmigung einzureichen. Die überarbeitete Prüfungsordnung ist einer Rechtsprüfung zu unterziehen.

    Neues PDF vom 26.07.2012 12:51:53

    Auflagen
    Die Auflagen wurden in der Sitzung der Akkreditierungskommission vom 24.07.2012 als erfüllt bewertet.

    Dort ist nun auch ein Kurzgutachten (PDF vom 19.06.2012 11:58:15) verfügbar.
    Die Gutachter:
    Martin Härter, Psychiater und Psychotherapeut am UKE Hamburg
    Götz Mundle, Oberbergklinik Berlin/Brandenburg
    Tobias Esch, Hochschule Coburg
    (Teilung wg. Anzahl Links)

  307. #313 ZetaOri
    4. August 2012

    (Fortsetzung)
    Insbesonder letzterer dürfte einigen schon bekannt sein, u.a. als Autor von
    “Die Neurobiologie des Glücks – Wie die Positive Psychologie die Medizin verändert”.
    In der Wiki und auf seiner Seite bei der HS-Coburg findet man neben einer Menge anderer Funktionen auch die des Vorsitzendes des Wissenschaftsbeirats (Scientific Advisory Board) des Instituts für Mind-Body-Medizin in Potsdam und seiner Mitgliedschaft im Alt-Wilseder-Forum der Karl und Veronica Carstens-Stiftung.
    Aber auch Götz Mundle taucht im gleichen Dunstkreis immer wieder auf. Sucht man auf der Seiter der Oberbergkliniken, deren ärztlicher Geschäftsführer Mundle ist nach Esch+Mundle+Walach findet man alleine 6 Veranstaltungen / Publkationen wo alle 3 gemeinsam auftauchen. Z.B. die Kongresse Meditation & Wissenschaft 2010 und 2012, Veranstaltungen der “Identity Foundation” und der “Oberberg Stiftung”, in Kooperation schon 2010 mit “West-Östliche Weisheit – Willigis Jäger Stiftung” und dieses Jahr zusätzlich mit dem “Lassalle-Institut” und der “Udo Keller Stiftung – Forum Humanum”. In den Flyern zu beiden Kongressen findet man die 3 einträchtig im wissenschaftlichen Kuratorium versammelt.
    Eine Google-Suche nach “Götz Mundle” “Harald Walach “Tobias Esch” bringt über 600 Ergebnisse, u.a. tauchen die 3 gemeinsam als Mitglieder des wissenschaftlichen Beirats im Impressum des Blattes
    “Spiritual Care”, Zeitschrift für Spiritualität in den Gesundheitsberufen (Organ der IGGS “Internationale Gesellschaft für Gesundheit und Spiritualität e.V.”) auf, oder als Referenten beim Symposium “Endogene Ekstase im Spiegel der Wissenschaft”.
    Aber ich muss jetzt erstmal Schluss machen, mir ist von den ganzen Verflechtungen ein wenig schwindelig. >;o)
    Gibt es bei den Akkreditierungsistituten nicht so ein Gebot bzgl. Unabhängigkeit?

  308. #314 Aiko
    4. August 2012

    Danke für diese Zusammenstellung.
    Aber – so viele Verflechtungen sind es nicht. Es sind vor allem ein paar Personen, die hier die Verbindung darstellen. Und auch da wird nur mit Wasser gekocht.
    Da ist der ehemalige Geschäftsführer der Oberbergkliniken, der jetzt Vorsitzender der Stitung West-Östliche Weisheit (WÖW) ist: Alexander Poraj.
    Die Identity Foundation ist gestiftet von Margret und Paul J. Kohtes, letzterer ist wiederum Vorsitzender des Präsidiums der Stiftung WÖW –
    http://www.west-oestliche-weisheit.de/stiftung/menschen-der-stiftung.html
    Zu Kohtes
    http://www.visionaeres-wirtschaften.de/de/kongress/vortraege-redner/34-paul-kothes

    Dieses Stiftungs-Unwesen steht ja auch im Zusammenhang der Regeln private Stiftungen stärker zuzulassen. Das fördert dann auch deren unsinnige “wirtschaftliche” Tätigkeiten. Da ist ja ein großer Markt vorhanden.

    Es wäre doch wünschenswert, wenn man das mal systematisch zusammen stellen könnte, als eine Art Handbuch der Verflechtungen.

  309. #315 Joseph Kuhn
    4. August 2012

    @ ZetaOri: Danke für den Hinweis. Das mutet nach all dem Rummel um den Studiengang und seine Auswüchse schon etwas seltsam an. Aber es ist ja auch etwas seltsam, dass der Schöngeist Jürgen Freiherr v. Troschke als Geschäftsführer der zuständigen Akkreditierungsagentur für Studiengänge im Bereich Gesundheit und Soziales fungiert, obwohl seine Verstrickungen in die Wissenschaftsmanipulationen der Tabakindustrie ebenfalls durch alle Medien gingen. Man geht in diesen Kreisen eben nett miteinander um, über vieles schweigt man lieber, zumal Freiburg so vieles verbindet.

  310. #316 ZetaOri
    4. August 2012

    @Joseph Kuhn· 04.08.12 · 17:50 Uhr

    [...] Aber es ist ja auch etwas seltsam, dass der Schöngeist Jürgen Freiherr v. Troschke als Geschäftsführer der zuständigen Akkreditierungsagentur für Studiengänge im Bereich Gesundheit und Soziales fungiert, obwohl seine Verstrickungen in die Wissenschaftsmanipulationen der Tabakindustrie ebenfalls durch alle Medien gingen.

    Jo, den hatte ich hier schonmal aufgespießt.
    Langsam kann ich die miese Meinung eines großen Teils der Bevölkerung über den akademischen Wissenschaftsbetrieb verstehen. :(

  311. #317 ZetaOri
    4. August 2012

    @Aiko· 04.08.12 · 17:43 Uhr

    Danke für diese Zusammenstellung.
    Aber – so viele Verflechtungen sind es nicht. Es sind vor allem ein paar Personen, die hier die Verbindung darstellen. [...]

    Auf die Anzahl der Leute kommt´s nicht so sehr an, sondern auf deren Einfluss. Der Skandal ist ja nicht, dass die auf irgendwelchen Séancen händchenhalten, sonder dass sie sich jetzt schon gegenseitig offiziell begutachten und akademische Persilscheine ausstellen.
    Demnächst sitzt Walach in `ner Akkreditierungskommission die einen Studiengang “Weiße Magie” an der Uni Freiburg akkreditiert.

    Es wäre doch wünschenswert, wenn man das mal systematisch zusammen stellen könnte, als eine Art Handbuch der Verflechtungen.

    Ja, das wäre sicher eine dankbare Aufgabe für Psiram / Esowatch. >;D
    Ich fürchte, das Bild das sich da ergibt könnte erschreckend sein.

  312. #318 Joseph Kuhn
    4. August 2012

    @ ZetaOri:

    “Langsam kann ich die miese Meinung eines großen Teils der Bevölkerung über den akademischen Wissenschaftsbetrieb verstehen.”

    Sehen wir’s mal positiv: Das zeigt auch die hohe Bedeutung, die die Wissenschaft heute hat. Die Esoterik will sich wissenschaftlich geben, ebenso die Tabakindustrie und auch in der Beschneidungsdebatte werden Studien bemüht …

  313. #319 Thilo
    4. August 2012

    Gibt es irgendwelche Zweifel an der Seriosität der Studien zur Zirkumzision? Die haette man dann im dortigen Thread diskutieren sollen, dann wäre die Diskussion dort wenigstens zu etwas gut gewesen.

  314. #320 Thilo
    4. August 2012

    @ Zeta Ori:
    Die Verflechtungen bei Gutachten aufzuklären stelle ich mir schwierig vor, denn diese sind ja in der Regel anonym. Aber es sollte sich wohl herausfinden lassen, wer in welchen Gremien sitzt und Entscheidungen fällt.

  315. #321 ZetaOri
    4. August 2012

    @Joseph Kuhn· 04.08.12 · 19:31 Uhr

    @ ZetaOri:
    Sehen wir’s mal positiv: Das zeigt auch die hohe Bedeutung, die die Wissenschaft heute hat. Die Esoterik will sich wissenschaftlich geben, ebenso die Tabakindustrie und auch in der Beschneidungsdebatte werden Studien bemüht …

    Ja, ist mir schon klar, war auch nicht so ernst gemeint. :D
    Andererseits ist die Tendenz zu fortschreitender Privatisierung im Bildungsbereich und die damit einhergehenden Effekte wie z.B. die Jagd nach Mitteln / Sponsoren, die (Nicht-)Reaktion von Uni-Leitungen auf kritische Berichterstattung schon recht beängstigend.
    Und wenn man sich mal das Gutachten der Akkreditierungkommission anschaut, ist das eine einzige Empfehlung zu verbaler Kosmetik um die Akkreditierung zu retten.
    Da haben einige Leute jetzt bei Walach was gut.

  316. #322 Thilo
    4. August 2012

    Unbestätigten Verschwörungstheorien nach sollen es ja auch Walach und seine Freunde gewesen sein, die hinter dem Kölner Urteil steckten. Was sie damit erreichen wollten: Das in Wissenschaftsblogs über andere Themen diskutiert wird als über die Viadrina. Zuzutrauen wär’s ihnen. (Nur um das Thema hier zum Abschluss zu bringen.)

  317. #323 Thilo
    4. August 2012

    Jetzt wieder ernsthaft: Aus meiner Zeit in Deutschland erinnere ich mich, dass die Leute oft genervt waren wegen der Akkreditierungen ( selbst hatte ich mit dem Thema nichts zu tun), wegen des bürokratischen Aufwandes, der Kosten und weil man irgendwelchen Fachfremden die Inhalte des Studienganges erklären muss.

    Früher haben Universitäten mal selbst entschieden, welche Fächer sie anbieten. (Gut, das musste von Ministerien bestätigt werden, aber das war doch eher eine Formsache.) Die Rechtfertigung für das aufwendige Akkreditierungsverfahren ist ja wohl, dass man eine unabhängige Kontrolle der Studieninhalte will, weil man offenbar der Selbstkontrolle der Wissenschaft nicht mehr vertraut. (Warum eigentlich?)

    Jedenfalls, wenn, wie es sich ja jetzt bei der Viadrina darzustellen scheint, es gerade umgekehrt ist, dass durch die Akkreditierungsagenturen Unwissenschaft an die Universitäten gebracht wird, dann wäre das wohl auch einmal ein Aufhänger, den Sinn und Nutzen des Verfahrens überhaupt in Frage zu stellen. Eine ausserwisenschaftliche Instanz, die die Arbeit der Unis bewertet ( zumindest die angebotenen Studiengänge ) ist ja geradezu eine Einladung zu Korruption und allen Arten von Einflussnahme von außerhalb der Wissenschaft.

    Nebenbei: das mit dem Troschke ist wirklich seltsam. Der Mann ist über 70, warum arbeitet der noch als Geschäftsführer einer Akkreditierungsagentur? Und falls sich die im Spiegel damals angedeuteten Korruptionsvorwurfe belegen liessen, dann wäre das jetzt natürlich auch eine tolle Basis für alle möglichen Verschwörungstheorien :-)

  318. #324 Aiko
    4. August 2012

    @Thilo

    Wenn ich mir die Liste der Leute in dem Gremium ansehe – das ist ein Bürokraten-Blödsinn – noch ‘ne Stiftung und noch ‘ne Kommission und das kann man locker unterlaufen, denn die sitzen da ja drin und dösen bei ihren Entscheidungen. Es kommt auch gar nicht drauf an – wird durch gewunken, wie die Gesetze im Parlament.
    Tja – so macht man die Lehre kaputt – und dann hat man nur noch die allgemeine Verwirrung. Und in den Hochschulen sind eh schon die Wirtschaftsinteressen am Zuge.

  319. #325 Aiko
    4. August 2012

    Stiftungsprofessur – ich krieg’ die Krise. Da macht sich das Wissenschaftssystem eben selbst kaputt – mit solchem Geld.

    http://www.uni-due.de/naturheilkunde/newsletter/2012_01/index.htm

  320. #326 Joseph Kuhn
    4. August 2012

    @ Thilo: Die Akkreditierungen, um die es hier geht, sind durch den Bologna-Prozess notwendig geworden, um in Europa Vergleichbarkeit von Studienmodulen zu gewährleisten, daher sind die Akkreditierungen auch so stark auf formale Aspekte (workload etc.) ausgerichtet.

    Was v. Troschke angeht: Über seine Beziehungen zur Tabakindustrie kann man sich leicht in den Tabakindustriedokumenten informieren, die im Gefolge der großen Prozesse in den USA veröffentlicht werden mussten: http://legacy.library.ucsf.edu/ – die Suchfunktion dort ist einfach wie google.

    Dass für die Akkreditierung des Viadrina-Studiengangs ausgerechnet die Agentur in Freiburg zuständig ist, bei der v. Troschke Geschäftsführer ist, ist kein Anlass für “Verschwörungstheorien”, das ist ein bürokratischer Zufall, wenn man so will, eine Ironie der Wissenschaftsgeschichte.

  321. #327 Ponder
    7. August 2012

    @ ZetaOri:

    Aber ich muss jetzt erstmal Schluss machen, mir ist von den ganzen Verflechtungen ein wenig schwindelig. >;o)

    Das Schwindelgefühl befiel uns bei Psiram (ehem.Esowatch) exakt so, als wir vor ca 2 Jahren den CAM-Studiengang an der Viadrina und die im Umfeld sich formierenden Netzwerke recherchierten.

    Ja, das wäre sicher eine dankbare Aufgabe für Psiram / Esowatch. >;D
    Ich fürchte, das Bild das sich da ergibt könnte erschreckend sein.

    Zu meinen ganz persönlichen damaligen Prognosen gehörte, dass der Oberguru Gerald Hüther (“Deutschlands meist zitierter Hirnforscher”, jedoch bei wirklichen Neurowissenschaftlern akademisch in Ungnade gefallen – siehe das entspr. Psiram-Lemma…) doch wohl das optimale “neurobiologische Feigenblatt” für Walachs Thesen darstellen würde und womöglich als Neurowissenschaftler an die Viadrina berufen weden könnte…
    Ganz so schlimm kam es dann vorerst nicht – vermutlich auch wegen der durch Psiram erfolgten kritischen Darstellung von G.Hüthers pseudowissenschaftlichem Gebaren – , aber immerhin ist Hüther nun Wissenschaftlicher Beirat in Tobias Eschs Mind & Body Medicine und zumindest von Göttingen nach Potsdam kurz vor die Tore der Viadrina gerückt:
    http://www.mind-body-medizin.org/index.php?article_id=33&clang=0#Prof%20Dr.%20Dr.%20Gerald%20H%C3%BCther

    Auch bei den Oberberg-Veranstaltungen, im Umfeld von Willigis Jäger und im Rahmen der Stiftung Heiligenfeld http://stiftung.heiligenfeld.de/
    trifft man die sattsam bekannten Protagonisten in immer neuen Kombinationen an.

    Und ähnlich “synchronisierend” wirkt auch die Boulevard-Berichterstattung:

    http://www.derwesten.de/gesundheit/schulmedizin-setzt-auf-krebs-heilung-durch-handlauflegen-id4216115.html

    Alternative Medizin
    Schulmedizin setzt auf Krebs-Heilung durch Handlauflegen
    28.01.2011 | 08:19 Uhr

    … Ob Hypnose, Meditation, Handauflegen (Therapeutic Touch) oder Cranio-Sacral-Therapie (Handgriffe im Bereich des Schädels und des Kreuzbeins, um die Bewegungen zu optimieren) – bei Laien sind diese Therapien beliebt. Die Wissenschaft allerdings tut sich schwer. Denn plausible Nachweise zum Nutzen konnten kaum erbracht werden.

    Doch das könnte sich ändern. Joachim Faulstich, Autor und Regisseur, der sich seit über dreißig Jahren mit der Kraft des Geistes für den Prozess der Heilung befasst, hat nun mehrere Hirnforscher auf seiner Seite. Experten wie Dr. Tobias Esch, Gesundheitswissenschaftler. Professor für Integrative Gesundheitsförderung an der Hochschule Coburg und Dozent für Neuro-Wissenschaften an der State University von New York.

    Für Esch ist es klar, dass alternative Heilmethoden wie Urzeit-Rituale Effekte in den Hirnregionen hervorrufen, die für die Selbstheilung zuständig sind. Zum gleichen Ergebnis kommt Prof. Dr. Gerald Hüther, Leiter der Zentralstelle für Neurobiologische Präventionsforschung der Universitäten Göttingen und Mannheim/Heidelberg. Für ihn sind emotionale Reaktionen wie das Vertrauen zum Therapeuten für die Selbstheilung entscheidend. So überrascht es ihn nicht, dass Wunden allein durch Handauflegen heilen. Denn alte Rituale führten zu einer Neu-Verschaltung im Gehirn, die die Heilung begünstige…

  322. #328 Wissender
    12. August 2012

    Schade, das ihr in Wirklichkeit so wenig wisst hier bei Scienceblogs & Co und einer Skeptikerbewegung angehört, die in falschen Bahnen agiert.

    Wenn ihr euch ausreichend mit der Quantenphysik beschäftigt hättet, wüsstet ihr schon viel mehr, aber da ihr hier sehr rückständig zu sein scheint und in Rahmen denkt, die bereits längst gesprengt und widerlegt bzw. erweitert worden sind, kann man euch lediglich bemitleiden als aufgeklärter (im erweiterten Sinne) Mensch.

    Vielleicht solltet ihr euch mal ein paar Vorträge von verschiedensten Prof. Dr. anhören, die euch bereits weit voraus sind.

    Hier zB http://www.youtube.com/user/QuanticaGmbH

    Lernt erstmal noch schön und in paar Wochen evtl. kann man euch in einem besseren geistigen Zustand begegnen, aber das liegt ganz an euch bzw. an DIR!

    bis dahin alles Gute und viel Erfolg!

  323. #329 rolak
    12. August 2012

    Nur um mal den harten Kern aus Walachs wachsweicher, mißbräuchlicher Physik­ver­wen­dung im Rahmen der WQT herauszuschälen: Hartmann Römer – Ist die Quantentheorie außerhalb der Physik anwendbar? (inkl QT-Basics). Ein Dreiviertelstündchen Bildungs­programm, das er im Zuge seines Werdens offensichtlich inhaltlich verpaßt hat.

  324. #330 Joseph Kuhn
    12. August 2012

    @ rolak:

    Hartmann Römer nimmt in seinem Vortrag genau die gleichen Anwendungen von Begriffen der Quantentheorie auf Alltagssituationen vor wie Walach, z.B. sieht er das Übertragungs-/Gegenübertragungskonzept der Psychoanalyse als Beispiel für eine Verschränkung wie in der Quantentheorie. Ich glaube, da gehen die Pferde des analoghaften Denkens mit ihm durch. Man sollte sich an solchen Punkten bewusst machen, dass dieses analoghafte Denken nicht durch seine Fachkompetenz als Physiker gedeckt ist, in Bezug auf die Psychonalayse spricht er als Laie.

  325. #331 rolak
    12. August 2012

    Dieselben Begriffe ja, Joseph, aber imho in keiner Weise eine vergleichbare Anwendung. Geht es ihm doch nicht um “eine Verschränkung wie in der Quantentheorie”, sondern um <ähnlich aussehend wie eine Verschränkung in der Quantentheorie>. Das wäre dann sogar von seinem – und auch für jeden anderen jenseits seines Kenntnis­gebietes – unbezweifelten Status als Laien beurteilbar.
    Hinter seinem Vortrag höre ich als Antwort auf die Titelfrage ein deutliches “Nein, eigentlich nicht, obgleich es manchmal so wirkt.”; kann selbstverständlich ein auf geheimnisvoll verschränkte Weise entstandener Fehleindruck sein.

  326. #332 Aiko
    12. August 2012

    Ich finde das ein erschreckendes Zeugnis von Borniertheit unter den Physikern und das hat ja schon Pauli vorgelebt. Man kann auf der wissenschaftlichen Ebene ein hervorragender Fachmann sein und auf der persönlichen Ebene einfach eine Null. Null-Ahnung eben – und hier missbraucht dann jemand seinen Ruf – den sollte er aber auch dann verlieren.

  327. #333 Aiko
    12. August 2012

    Hier findet sich Römer in illustrer Gesellschaft.
    http://www.youtube.com/user/QuanticaGmbH

  328. #334 Joseph Kuhn
    12. August 2012

    @ rolak:

    Das “Nein” am Ende seines Vortrags höre ich nicht, ich höre da nur einen weiteren schrägen Vergleich, nämlich eine Analogie zwischen Quantentheorie und Träumen. Hartmann Römer wirkt als Person sehr symphatisch, aber ich glaube, er macht in seinem Vortrag genau das, was Sokal und Bricmont in ihrem Buch “Eleganter Unsinn” bei manchen postmodernen Philosophen anprangern – er verwendet naturwissenschaftlich sinnvoll definierte Konzepte in einem Kontext, in dem sie nicht definiert sind und bestenfalls metaphorische Funktion haben. Solche Brüche in der Konsistenz einer Weltsicht sieht man, wie “Aiko” schon angemerkt hat, immer wieder auch bei wissenschaftlich höchst kompetenten Geistern, vor ein paar Monaten hatten wir das bei Wolf Singer. Wenn es nicht überhand nimmt, ist das vielleicht auch nicht so schlimm und gehört wohl zum “Allzumenschlichen”, das wir alle gemeinsam teilen.

  329. #335 rolak
    12. August 2012

    Hmmm, muß ich mir vielleicht nochmal anhören; sooo dolle wars nun auch nicht… Aber nicht heute.

    Generell ist niemand davor gefeit, irgendwelchem Unsinn anzuhängen, natürlich. Allein das zu bezweifeln wäre auch nur wieder so ein Unsinn – catch 22 ;-)

  330. #336 rolak
    13. August 2012

    Tja, beim zweiten Hören (diesmal mit Sehen), heute, nüchtern und konzentriert stellt sich mir der Vortrag (für Querleser: Den gibt es auch als slide-pdf, die meisten Schwächen werden allerdings im Gesprochenen erst deutlich) deutlich schlechter dar als gestern noch, ich klatsche schnell das üblicherweise beim Lesen/Hören/Sehen entstehende comment-script hier rein (Zeilenend +/- ist ne Miniwertung)

    • #src YT/watch?v=LywTkPzojVc
    • #rem
    • #- NeckerWürfel:
    • #16:52 “..sicherlich nicht, weil wir glauben, daß Quantenphysik im Spiel wäre” +
    • #17:40 Zweizustandssystem, Pendelzeit t0, Meßzyklus dt, des paßt scho … doch Betrachtung eines Bildes ist *keine* Messung des Systems -
    • #- Verschränkung
    • #23:35 “nicht lokal, *scheinen* Raum und Zeit zu überspringen” *me* +
    • #24:12 “keine Informationsübertragung” +
    • #25:25 “phänomenologisch, nicht die Mechanismen ergründend” +
    • #27:13 Bsp Gegenübertragung arg konstruiert, Empathie ist keine Folge von Verschränkung. Doch er *nennt* es nur so, weist darauf hin, daß es deswegen noch nicht so *ist*. +
    • #- Doppelspalt
    • #35:21 daß eine überlegte Handlung anders sein kann als eine unüberlegte, läßt sich selbst bei größtem Entgegenkommen nicht mit mit DS-Effekten analogisieren -
    • #-
    • #41:41 gen Ende wird es ziemlich wirr:
      -beim Menschen QT-Inneres, klassisch Äußeres -
      -Heraklit-Zitat mißbraucht, subjektiv/intersubjektiv *ist nicht* QT/klassisch -
    • #- insgesamt hohl; lokal zu schlecht um global gut zu sein
    • #/rem

    Wackelige Sachen sollte ich wahrlich nicht nebenbei, nicht zu angeregt (Coffein, Balkon­früh­stück und neither last nor least multiple Oxytocin-Ausschüttung) und generell nicht bei zu positivem Setting ‘mitnehmen’. Führt offensichtlich zum Überhören/sehen von Ungewoll­tem, Unpassendem; allgemein zu zu positiven Wertungen ;-)

    Nichtsdestotrotz halte ich (Person gefällt mir)-Wertung, Allgemeinplatz (jeder macht iwann Mist) und Bewertung durch playlists Dritter, wie es Aiko oben vortrug für in keiner Weise angemessen oder diskutabel.

  331. #337 Aiko
    14. August 2012

    Hier nochmal der Vortrag auf der Seite des SWR .
    Es ist ja die Reihe der Uni zum Studium Generale, Samstags-Uni – gemeinsam mit der VHS – Freiburg – und ein Blick ins Publikum macht deutlich, wer da Samstags sich das anhört.

    http://www.tele-akademie.de/begleit/video_ta111204.php

    Worüber ich immer wieder sehr erstaunt bin, dass die Quantentheorie durch manche Physiker selbst auf ein Banalitätsniveau herunter gebrochen wird, das mich jedenfalls erschüttert.
    Ich will nur zwei Einwände vorbringen -
    1. Objektbegriff – in der Quantentheorie gibt es nur “theoretische” Objekte – Objekte im Sinne der klassischen Physik existieren nicht.
    Damit löst sich auch der Subjektbegriff auf.
    2. Eine Übertragung auf die Psychologie, die ja das Subjekt betrachtet ist deshalb auch nicht möglich.
    3. Der Satz: Im Inneren des Menschen geht es quantenartig zu” – ist nur Schwachsinn.

    Was hier Römer macht, und da ist er voll verantwortlich zu machen, er nimmt Gedanken aus anderen Wissenschaften, die er aufgrund seiner Inkompetenz nicht beurteilen kann, formuliert sie auf sein Gebiet um, und schafft somit Unsinn, verpackt in wissenschaftliche Worthülsen. Damit ist er in doppeltem Sinn ein Gläubiger – er glaubt was er da sagt und hat keine kritische Distanz zu seinem Fach selbst.

    4. Messung
    Jede Messung ist eine Wechselwirkung von Objekt und Subjekt, die erst auf der Ebene der Quantenmechanik – bei Auflösung von Objekt und Subjekt-Bestimmung, zum eigenständigen Problem wird.

    Noch ein abschließender Satz aus der Unsinnskiste des Herrn Römer:
    “Wie gehen nicht direkt mit “Dingen” um, sondern immer mit Repräsentationen im menschlichen Geist”.

    Das ist doch eine schöne Forschungsaufgabe: was für eine Repräsentation im Geist der drei Atmanspacher, Römer, Walach – ist diese “Theorie”?

    http://parapsychologie.ac.at/programm/ws200910/roemer/paranorm.pdf

    Link repariert

  332. #338 Joseph Kuhn
    15. August 2012

    Wie die Römersche Quantenphilosophie zeigt, hängt irgendwie alles mit allem zusammen, oder anders formuliert, man trifft immer wieder auf die gleichen Namen:
    http://www.stiftung.heiligenfeld.de/files/Symposium_Bewusstsein_121_web.pdf

  333. #339 rolak
    15. August 2012

    Schöne Formulierung :-)

    Allerdings sind auch bei jedem wissenschaftlichen Exotenthema (als Beispiel mal der nichttanzende Twistor) die Listen der Referenten verschiedener Symposien oder die der Namen in Quellenangaben diverser Texte mit auffälligen Gemeinsamkeiten gespickt. Ich halte es daher für riskant, eine inhaltliche Bewertung nach solchen Randeffekten vornehmen zu wollen.
    Vielleicht wäre für eine derartige Außenanalyse die Inspektion der paper-Publikationen besser, die, wenn sie überhaupt existieren, typischerweise eher unter ‘Binnenkonsens’ fallen.

    Allerdings befürchte ich, daß zumindest ausgewählte Exemplare einer inhaltlichen Bewertung unterzogen werden müssen – ‘befürchte’, weil bei diesen schier unendlichen Massen von Text, Ton und Bild schon ein “ich ignoriere fast alle” in Sysiphusarbeit ausartet.

  334. #340 Ponder
    15. August 2012

    Vielleicht wäre für eine derartige Außenanalyse die Inspektion der paper-Publikationen besser, die, wenn sie überhaupt existieren, typischerweise eher unter ‘Binnenkonsens’ fallen.

    …oder die Editorial Boards mancher Zeitschriften:

    http://content.karger.com/ProdukteDB/produkte.asp?Aktion=JournalEditorial&ProduktNr=224242

    …oder die personelle Zusammensetzung, bzw Selbstverständnis-und Zielbeschreibungen bestimmter Stiftungen:

    …Die Zielsetzungen der Aufklärung, die die Idee eines souveränen Menschen formulierten, werden aufgegriffen, weiterentwickelt und praktisch umgesetzt. Ein souveräner Mensch lebt aus der Erfah­rung der unauflösbaren Verbundenheit zu seinen Mitmenschen und seiner Mitwelt.

    Aus dieser Er­fahrung entspringt ein Wertesystem, dass die Würde zu sich selbst als geschenkte und verantwor­tungsvolle Teilhabe am gesamten kosmischen Geschehen erfährt.

    Das alltägliche Handeln ist dann nicht mehr durch abstrakte und moralische Sollens-Vorschriften beherrscht, sondern wird von der intensiven Erfahrung der Verbundenheit geleitet…

    …Dabei zielt die Tätigkeit der Stiftung nicht nur auf eine Weiterentwicklung des einzelnen Menschen. Es ist eine wesentliche Aufgabe, zu einer neuen Kultur beizutragen, in der die “Arbeit am Be­wusstsein” als ein gesellschaftlich wertvolles Ziel anerkannt wird.

    Da der Bereich der Be­wusstseinsbildung derzeit nicht als Aus- und Weiterbildung explizit ausgewiesen ist, gibt es dafür auch bislang keine ausreichende institutionelle Förderung und öffentliche Vertretung. Dieses Defi­zit in der öffentlichen Wahrnehmung und Interessenvertretung will die Stiftung vermindern.

    http://stiftung.heiligenfeld.de/index.php?option=com_content&view=article&id=2&Itemid=3

  335. #341 Aiko
    15. August 2012

    Das alles erinnert mich an Kudzu
    http://de.wikipedia.org/wiki/Kudzu_%28Pflanze%29

  336. #343 rolak
    15. August 2012

    Das hat mit elektromagnetischen Feldern und dadurch bedingter, gruppenbildender gegenseitiger Anziehung zu tun, Ponder.

  337. #344 Ponder
    15. August 2012

    @ rolak:

    dadurch bedingter, gruppenbildender gegenseitiger Anziehung

    Schon auch, aber nicht nur. Es scheint auch besondere Katalysatoren zu geben, die es schaffen, trotz wissenschaftlicher Nullaussagen bzw Küchenpsychologie in politisch relevante Bereiche vorzudringen – und das bringt mich ins Grübeln:

    http://www.aerzteblatt.de/pdf/108/39/a1995.pdf

    https://www.dialog-ueber-deutschland.de/DE/10-Dialog/30-Wie-Lernen/wielernen_node.html

    http://www.deutscher-schulleiterkongress.de/dslk-2012/videos-dslk-2012/hauptvortrag-prof-dr-gerald-huether.html

    Wie gesagt, im Boot von Tobias Esch (s.o.) sowie über weitere potentielle und reale Ankerplätze in Walachs Umfeld schippert dieser Mensch durch die weit verzweigten Delta-Arme unserer gesundheits-und bildungspolitischen Landschaft, sammelt Kreti und Pleti unter seinen Anhängern, aber auch Menschen des öffentlichen Lebens und der Wissenschaft.
    In sofern ist er ein Bruder im Geiste von Harald Walach – nur in gesellschaftspolitischer Lobbyarbeit wesentlich erfolgreicher – trotz seines akademischen Fiaskos in Göttingen (welches er geschickt zu verbergen weiß).

  338. #345 rolak
    15. August 2012

    aber nicht nur

    Auch wenn ich manchmal die Welt umarmen könnte, sind meine Äußerungen nicht (und falls doch, dann sehr selten) allumfassend, Ponder. Der Wirkstoff eines sozologischen Katalysators heißt afaik Charisma.
    Doch es dürfte noch wesentlich mehr im Spiel sein, neben einer amoklaufenden Muster­er­kennung beim Suchenden auch eine (gefühlt) drastisch steigende mittlere Leckage beim humanen Gedächtnis – insbesondere alles was stören könnte wird besonders gerne und schnell ignoriert.

    So gehe ich zB davon aus, daß DBro-ers die durch das Ausbleiben des für Mai als aber sowas von sicher prophezeiten Megaflares initiierte Auszeit für die Arbeiten an einer Imagepolitur nutzt und in nicht allzu ferner Zukunft wie aus dem Ei gepellt wieder auf der Bühne der Verführer steht und alle seine Jünger psalmodieren “Ja der Dieter hatte schon immer bei allem Recht!”.

    Zum Auswachsen…

  339. #346 Aiko
    16. August 2012

    @rolak

    Charisma ist was für Romantiker. Der saubere Herr Maschmeyer und der noch saubere Herr Wulff – haben doch gezeigt, wie das geht – Beziehungspflege nennt sich das. Und das hat Maschmeyer in seinem Buch erzählt.
    http://www.amazon.de/Selfmade-erfolg-reich-Carsten-Maschmeyer/dp/3424200670

    Und das kennt man aus den asiatischen Ländern auch – Süd-Korea, Japan, China – nix geht da ohne ein Netzwerk und eine Liste von Kontakten und deren Pflege. Daraus ergeben sich dann wie von selbst, alles weitere.

  340. #347 rolak
    16. August 2012

    Ohne den Betroffenen etwas wegnehmen zu wollen, Aiko, doch Charisma ist keineswegs nur für Romantiker. Und die von Dir angeführte Beziehungspflege kann schon nach Wortaufbau erst dann wirken, wenn schon eine Beziehung vorhanden ist.
    Wenn Du einmal nachgeschaut hättest, wäre dir klar geworden, daß es mir um Gruppenbildung geht, nicht um den unter Gläubigen wesentlich leichteren Gruppenerhalt.

  341. #348 Aiko
    16. August 2012

    @rolek
    Okay – dann sagen wir es mal so: Charisma ist was für Gläubige.

    Natürlich muss ich Beziehungen erst einmal herstellen – aber das ist recht einfach, schließlich ist jeder immer in irgendwelchen Beziehungsfeldern. Kontakte tragen sich dann auch selbst. Man nennt so was ja auch networking.

  342. #349 Ponder
    16. August 2012

    Schau an, da haben wir sie doch – fast – alle, vereint in trauter Beziehungspflege und mit meditativ-ganzheitlichem Charisma:

    http://www.meditation-wissenschaft.org/programm.html

    14.20 Uhr: Vortrag
    In der Ruhe liegt die Kraft
    Neurobiologische Validierung einer Volksweisheit

    Prof. Dr. Gerald Hüther, Präsident der Sinn-Stiftung und Leiter der Zentralstelle für Neurobiologische Präventionsforschung der Univ. Göttingen und Mannheim/Heidelberg

    Der wahre Grund für die krankmachende Hektik unserer gegenwärtigen Kultur ist nicht der ständig beklagte Zeitmangel, sondern unsere Unfähigkeit herauszufinden, was für uns wirklich wichtig ist. Aus neurobiologischer Perspektive wird der Frage nachgegangen, weshalb es für die Entfaltung der in unserem Gehirn angelegten Potenziale notwendig ist, zu erkennen und uns bewusst zu machen, was tatsächlich für die Gestaltung des eigenen Lebens bedeutsam ist, und das eigene Handeln an dieser Erkenntnis auszurichten.

    Stress bei Studierenden und Ansätze zur Bewältigung
    Vorstellung einer Studie zur Implementierung eines 8-wöchigen Stressmanagement-Curriculums im Lehrplan

    Prof. Dr. med. Tobias Esch, Fachleitung „Gesunde Hochschule“, Hochschule Coburg

    Stress macht auch vor den Toren der Hochschulen nicht halt: Bologna-Reform und Prüfungsmarathons stellen neben den besonderen Lebensumständen typische Stressoren unter Studierenden dar. In Coburg haben wir umfassende Daten zur Ausgangssituation gewonnen und einen Stressmanagement-Kurs auf Basis der Mind-Body-Medizin (MBMSR) etabliert. Die Wirksamkeit dieser Maßnahme wurde in einem randomisiert-kontrollierten Setting mit externem Monitoring evaluiert.

    Meditieren Sie – aber bitte so effektiv wie möglich…
    Passt die Achtsamkeit in die Arbeitswelt?

    Prof. Dr. Stefan Schmidt, Institut für Transkulturelle Gesundheitswissenschaften, Europa Universität Viadrina, Frankfurt (Oder), Forschungsgruppe Meditation, Achtsamkeit und Neurophysiologie, Universitätsklinikum Freiburg

    Die Achtsamkeitsmeditation hat sich bei der Stressbewältigung und in der Medizin als sehr erfolgreich erwiesen und sich damit auch für die Anwendung in beruflichen Kontexten empfohlen. Neben der Stressreduktion zeigen sich zahlreiche weitere Anwendungsfelder, beispielsweise indem der Ansatz als metakognitive Technik zur Fehlerreduktion eingesetzt wird. Doch wie passt diese Funktionalisierung zur spirituellen Herkunft des ursprünglichen Konzeptes von Achtsamkeitsmeditation? Wie verhält es sich mit dem Widerspruch von Zielorientierung und Absichtslosigkeit?

    15.50 Uhr Podiumsdiskussion
    Neue Bewusstseinskultur in einer aus den Fugen geratenen Welt
    Moderation: Gert Scobel

    Teilnehmer:

    …Prof. Dr. med. Götz Mundle, Ärztlicher Geschäftsführer Oberbergkliniken und Chefarzt der Oberbergklinik Berlin/Brandenburg

    Das ist immer die gleiche Truppe; ab und zu wird einer der Protagonisten ausgetauscht- man kann schon fast Wetten abschließen, auf welche Namen man stößt, wenn man die entsprechende Veranstaltungsankündigung findet.

    Meine Kollegen von Psiram (und zeitweise auch ich selbst) haben das anfangs (vor ca 3 Jahren) für eine fixe Idee gehalten – a la amoklaufende Mustererkennung eben.

    Leider lehrt uns die Entwicklung das Gegenteil: die Ideenschmiede konsolidiert sich und arbeitet stringent an einem gesundheitspolitischen Paralleluniversum :(

  343. #350 Joseph Kuhn
    23. Oktober 2012

    Ein Update: Letzte Woche wurde Harald Walach das “Goldene Brett” verliehen, ein Preis, den die Skepikerbewegung für den “herausragendsten Unfug des Jahres” vergibt, wie es auf der Internetseite des Preises heißt. Dass Harald Walach durch die Verteidigung der seltsamen Masterarbeit über den Kozyrevspiegel ein würdiger Preisträger ist, steht außer Zweifel. Vielleicht sieht er das in irgendeiner Ecke seines Gehirn selbst so, jedenfalls hat er doch tatsächlich jemanden zur Preisverleihung geschickt und eine Danksagung verlesen lassen, die er auf seiner privaten Homepage online gestellt hat:
    http://harald-walach.de/2012/10/22/harald-walach-zur-verleihung-von-das-goldene-brett-2012/

    Eines muss man ihm lassen: Er hat Humor, sein Einstieg ist echt witzig: “Versammelte Gemeinde, werte Jury, ich bedanke mich von Herzen für die Ehre, heute diesen bedeutsamen Wissenschaftspreis entgegen nehmen zu dürfen. Der Nobelpreis wäre mir lieber gewesen, das gebe ich offen zu, aber ‘Das Goldene Brett’ ist die zweitbeste Wahl, kommt der Preis doch von der zweitwichtigsten Kommission zur Beurteilung guter Wissenschaft nach dem Nobelpreiskomitee.”

    Unfreiwilliger Humor kommt hinzu. Am Ende revanchiert er sich mit der Verleihung der “Silbernen Schere im Kopf” an Esowatch. Man hat den Eindruck, alles, was er hier sagt, sagt er eigentlich über sich selbst. Die “Silbere Schere” sei ein Preis “für die besondere Fähigkeit, sich gegen Informationen zu immunisieren, die der eigenen Weltanschauung zuwider laufen und überhaupt nur solche Informationen zur Kenntnis nehmen zu müssen, die die eigene Überzeugung stützen.” Darunter leider wir sicher alle gelegentlich, Harald Walach aber in besonderem Maße. Bei dem Satz hat er wohl zu lange in den Kozyrev-Spiegel geschaut.

    Von selbigem Spiegel kommt übrigens in seiner Dankesrede kein Wort vor. Das Thema meidet er – was er früher hätte tun sollen. Statt dessen meint er feststellen zu müssen, seine Kritiker hätten etwas gegen Achtsamtkeit, Innehalten oder Meditation. Weit gefehlt. Die meisten brauchen dazu nur keine Aluröhre und Kontakt mit Verstorbenen.

  344. #351 Ulrich Berger
    5. November 2012

    Noch ein Update zur Psychokozyrevision und zur Aluröhrenforschung bzw. deren Verteidigung durch Walachs Stellvertreterin im “Standard”: http://derstandard.at/1350260208331/Lobbyisten-des-Humbugs

  345. #352 Joseph Kuhn
    6. Februar 2013

    Aus dokumentarischen Gründen:

    Die Arbeit Conrads ist nun, interesssanterweise mit Conrad als Autor in mittlerer Position, zwischen Schmidt und Walach, in der “Zeitschrift für Anomalistik” veröffentlicht worden. Das INTRAG schreibt dazu:

    “Im vergangen Jahr hatte die Masterarbeit von Peter Conrad viel Wirbel und Kritik ausgelöst. Conrad hatte eine ungewöhnliche These in einem Experiment überprüft, konnte seine Hypothese jedoch nicht bestätigen. Nun ist in der Zeitschrift für Anomalistik die wissenschaftliche Publikation zu diesem Experiment und damit die erste offizielle Darstellung des experimentellen Vorgehens erschienen. Die Zeitschrift hat diese Arbeit im sogenannten Open-peer-review Verfahren publiziert. Dabei erscheinen im Anschluss an die eigentliche Publikation kritische Kommentare der Gutachter. Die Publikation und die zugehörigen Peer-review Kommentare sind auf unserer Homepage als pdf verfügbar.”

    Immerhin ist der Artikel in einer Zeitschrift erschienen, deren Namen dem Inhalt des Artikels gerecht wird. Es geht aber noch weiter: Das INTRAG wird nicht, wie von der Hochschulstrukturkommission des Landes Brandenburg empfohlen, abgewickelt. Dazu schreibt das INTRAG:
    “Die Europa-Universität Viadrina teilt mit: Die Kulturwissenschaftliche Fakultät der Europa-Universität Viadrina Frankfurt (Oder) hat Ende 2012 beschlossen, den Studiengang “Kulturwissenschaften – Komplementäre Medizin”, der von Mitarbeitern des Instituts für transkulturelle Gesundheitswissenschaften (IntraG) federführend geleitet wird, fortzuführen. Um eine gleichermaßen auf kulturwissenschaftlichem und auf medizinischem Sachverstand basierende wissenschaftliche Qualitätssicherung in Lehre und Forschung zu gewährleisten, wird das Institut innerhalb der nächsten 24 Monate eine gleichberechtigte Trägerschaft mit einer medizinischen Fakultät eingehen. Zusätzlich wird der Beirat durch die Kulturwissenschaftliche Fakultät neu besetzt.”

    INTRAG-Quelle: IntraG-Newsletter FEBRUAR 2013,
    http://intrag.info/newsletter/2013-02/#5